5EQI: Human GLUT1

Human GLUT1 in complex with Cytochalasin B. Determined by X-ray diffraction at 3.0 Å resolution. Released 13 Apr 2016.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,499
Mol. weight: 54.61 kDa
Ligands: 5RH
Released: 13 Apr 2016

Explore 5EQI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EQI contains 28 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 0 β-strands

Element	Residues	Length
α-helix	12-31	20
α-helix	37-52	16
α-helix	55-57	3
α-helix	58-90	33
α-helix	92-98	7
α-helix	100-111	12
α-helix	119-147	29
α-helix	150-156	7
α-helix	158-173	16
α-helix	186-191	6
α-helix	194-203	10
α-helix	204-206	3
α-helix	208-210	3
α-helix	211-212	2
α-helix	213-217	5
α-helix	221-232	12
α-helix	240-253	14
α-helix	255-256	2
α-helix	260-264	5
α-helix	269-283	15
α-helix	288-291	4
α-helix	294-300	7
α-helix	306-328	23
α-helix	333-357	25
α-helix	365-377	13
α-helix	386-391	6
α-helix	400-428	29
α-helix	434-451	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Solute carrier family 2, facilitated glucose transporter member 1	A	protein	492	Homo sapiens	P11166 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5EQI_1 Solute carrier family 2, facilitated glucose transporter member 1 (chains A)
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV

Ligands and cofactors

ID	Name	Formula	Copies
5RH	Cytochalasin B	C29 H37 N O5	1

Primary citation

Mechanism of inhibition of human glucose transporter GLUT1 is conserved between cytochalasin B and phenylalanine amides. Kapoor, K., Finer-Moore, J.S., Pedersen, B.P. et al. Proc Natl Acad Sci U S A (2016) 113:4711-4716. DOI 10.1073/pnas.1603735113 · PubMed

Other PDB entries of the same protein (UniProt P11166 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6THA 2.4 Å, Crystal structure of human sugar transporter GLUT1 (SLC2A1) in the inward conformation
5EQG 2.9 Å, Human GLUT1 in complex with inhibitor (2~{S})-3-(4-fluorophenyl)-2-[2-(3-hydroxyphenyl)et…
5EQH 2.99 Å, Human GLUT1 in complex with inhibitor (2~{S})-3-(2-bromophenyl)-2-[2-(4-methoxyphenyl)eth…
4PYP 3.17 Å, Crystal structure of the human glucose transporter GLUT1

Browse structure collections

About this viewer

MolViewer shows 5EQI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.