5EU1: BRD9

Crystal structure of BRD9 in complex with bi-7273. Determined by X-ray diffraction at 1.6 Å resolution. Released 9 Mar 2016.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,255
Mol. weight: 29.21 kDa
Ligands: 5SW
Released: 9 Mar 2016

Explore 5EU1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EU1 contains 14 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	24-38	15
α-helix	48-50	3
α-helix	57-60	4
α-helix	67-75	9
α-helix	82-99	18
α-helix	105-120	16
α-helix	123-132	10

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	24-37	14
α-helix	48-50	3
α-helix	57-60	4
α-helix	67-75	9
α-helix	82-99	18
α-helix	105-120	16
α-helix	123-132	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BRD9	A, B	protein	123	Homo sapiens	Q9H8M2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5EU1_1 BRD9 (chains A, B)
SMLKLSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMK
DKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKR
SMS

Ligands and cofactors

ID	Name	Formula	Copies
5SW	4-[4-[(dimethylamino)methyl]-3,5-dimethoxy-phenyl]-2-methyl-2,7-naphthyridin-1-…	C20 H23 N3 O3	2

Primary citation

Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor. Martin, L.J., Koegl, M., Bader, G. et al. J Med Chem (2016) 59:4462-4475. DOI 10.1021/acs.jmedchem.5b01865 · PubMed

Other PDB entries of the same protein (UniProt Q9H8M2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BQA 1.03 Å, BRD9 bromodomain in complex with 3-(6-(but-3-en-1-yl)-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]…
5I40 1.04 Å, BRD9 in complex with Cpd1 (6-methyl-1,6-dihydro-7H-pyrrolo[2,3-c]pyridin-7-one)
9ZU4 1.05 Å, Crystal structure of BRD9 bromodomain bound to BZ2
9ZU3 1.15 Å, Crystal structure of BRD9 bromodomain bound to BZ1
5I7X 1.18 Å, BRD9 in complex with Cpd2 (N,N-dimethyl-3-(6-methyl-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]py…
6Y7K 1.2 Å, Structure of the BRD9 bromodomain and compound 27
4UIT 1.3 Å, BROMODOMAIN OF HUMAN BRD9 WITH 7-(3,4-dimethoxyphenyl)-2-(4-…
6V1B 1.35 Å, Crystal structure of the bromodomain of human BRD9 bound to I-BRD9
5JI8 1.42 Å, Crystal structure of the BRD9 bromodomain and hit 1
4YY6 1.45 Å, Crystal structure of BRD9 Bromodomain bound to a butyryllysine peptide
5I7Y 1.45 Å, BRD9 in complex with Cpd4 ((E)-3-(6-(but-2-en-1-yl)-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]py…
4YY4 1.47 Å, Crystal structure of BRD9 Bromodomain bound to DMSO

Browse structure collections

About this viewer

MolViewer shows 5EU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.