5EV2: Splicing factor U2AF 65 kDa subunit

Structure II of Intact U2AF65 Recognizing the 3' Splice Site Signal. Determined by X-ray diffraction at 1.86 Å resolution. Released 24 Feb 2016.

Method: X-ray diffraction
Resolution: 1.86 Å
Organisms: Homo sapiens, Synthetic Construct
Chains: 2
Atoms: 1,914
Mol. weight: 24.72 kDa
Ligands: DIO
Released: 24 Feb 2016

Explore 5EV2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EV2 contains 11 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	144-147	4
β-strand	150-154	5	1
α-helix	156-157	2
α-helix	162-175	14
β-strand	186-192	7	1
β-strand	197-202	6	1
α-helix	205-211	7
α-helix	212-214	3
β-strand	218-219	2	2
β-strand	222-223	2	2
β-strand	225-227	3	1
α-helix	234-235	2
β-strand	251	1	3
β-strand	261-264	4	3
α-helix	272-279	8
α-helix	280-282	3
β-strand	285-293	9	3
β-strand	298-307	10	3
α-helix	310-312	3
α-helix	313-320	8
β-strand	324-325	2	4
β-strand	328-329	2	4
β-strand	331-334	4	3
α-helix	335-337	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor U2AF 65 kDa subunit	A	protein	201	Homo sapiens	P26368 (AlphaFold model)
DNA (5'-r(pupu)-d(pupu)-r(pu)-d(pup(bru)pu)-3')	B	NA-hybrid	8	Synthetic Construct

Sequence of entity 1 (A), FASTA

>5EV2_1 Splicing factor U2AF 65 kDa subunit (chains A)
GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFL
EFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK
LFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGL
NGMQLGDKKLLVQRASVGAKN

Sequence of entity 2 (B), FASTA

>5EV2_2 DNA (5'-R(P*UP*U)-D(P*UP*U)-R(P*U)-D(P*UP*(BRU)P*U)-3') (chains B)
UUUUUUUU

Ligands and cofactors

ID	Name	Formula	Copies
DIO	1,4-diethylene dioxide	C4 H8 O2	1

Water and common crystallization additives (PGE, PEG) are not listed.

Primary citation

An extended U2AF(65)-RNA-binding domain recognizes the 3' splice site signal. Agrawal, A.A., Salsi, E., Chatrikhi, R. et al. Nat Commun (2016) 7:10950-10950. DOI 10.1038/ncomms10950 · PubMed

Other PDB entries of the same protein (UniProt P26368 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0G 1.07 Å, Structure of U2AF65 (U2AF2) RRM1 at 1.07 resolution
5W0H 1.11 Å, Structure of U2AF65 (U2AF2) RRM2 at 1.11 Angstrom Resolution
6XLV 1.4 Å, Crystal structure of leukemia-associated N196K mutant of U2AF65 bound to AdML splice site
9C7A 1.4 Å, Crystal structure of R149W neurodevelopmental disease-associated U2AF2 variant
9C7B 1.4 Å, Crystal structure of R150H neurodevelopmental disease-associated U2AF2 variant
2HZC 1.47 Å, Crystal structure of the N-terminal RRM of the U2AF large subunit
7S3A 1.48 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-C5 oligonucleotide
5EV3 1.5 Å, Structure III of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLW 1.5 Å, Crystal structure of U2AF65 bound to AdML splice site sequence
7S3C 1.51 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-A5 oligonucleotide
5EV4 1.57 Å, Structure IV of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLX 1.7 Å, Crystal structure of cancer-associated G301D mutant of U2AF65 bound to AdML splice site

Browse structure collections

About this viewer

MolViewer shows 5EV2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.