5EZ5: Active Rab11A

Crystal structure of active Rab11A (S20V) in complex with GTP. Determined by X-ray diffraction at 2.4 Å resolution. Released 7 Dec 2016.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,696
Mol. weight: 39.08 kDa
Ligands: GTP, MG
Released: 7 Dec 2016

Explore 5EZ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EZ5 contains 17 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	1
α-helix	24-33	10
α-helix	40-44	5
β-strand	46-55	10	1
β-strand	58-67	10	1
α-helix	78-81	4
β-strand	86-92	7	1
α-helix	96-100	5
α-helix	102-112	11
β-strand	118-124	7	1
α-helix	129-131	3
α-helix	136-146	11
β-strand	149-152	4	1
β-strand	154	1	2
β-strand	159	1	2
α-helix	161-174	14

Chain B: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	3
α-helix	24-33	10
α-helix	40-44	5
β-strand	46-55	10	3
β-strand	58-67	10	3
α-helix	75-77	3
α-helix	78-81	4
β-strand	86-92	7	3
α-helix	96-100	5
α-helix	102-112	11
β-strand	118-124	7	3
α-helix	129-131	3
α-helix	136-146	11
β-strand	149-152	4	3
α-helix	161-174	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-11A	A, B	protein	168	Homo sapiens	P62491 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5EZ5_1 Ras-related protein Rab-11A (chains A, B)
YDYLFKVVLIGDVGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT
AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSD
LRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRI

Ligands and cofactors

ID	Name	Formula	Copies
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	2
MG	Magnesium ion	Mg	2

Primary citation

Crystal structure of active Rab11A (S20V) in complex with GTP. Shin, Y.-C., Yoon, J.H., Park, H.H. To be published.

Other PDB entries of the same protein (UniProt P62491 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OIX 1.7 Å, X-ray structure of the small G protein Rab11a in complex with GDP and Pi
2D7C 1.75 Å, Crystal structure of human Rab11 in complex with FIP3 Rab-binding domain
2HV8 1.86 Å, Crystal structure of GTP-bound Rab11 in complex with FIP3
1OIV 1.98 Å, X-ray structure of the small G protein Rab11a in complex with GDP
1YZK 2.0 Å, GppNHp bound Rab11 GTPase
4C4P 2.0 Å, Crystal Structure of Wild-Type Rab11 Complexed to FIP2
1OIW 2.05 Å, X-ray structure of the small G protein Rab11a in complex with GTPgammaS
5JCZ 2.06 Å, Rab11 bound to MyoVa-GTD
6IY1 2.11 Å, Structure of human Ras-related protein Rab11
4LX0 2.19 Å, Crystal structure of Myo5b globular tail domain in complex with active Rab11a
2GZD 2.44 Å, Crystal Structure of Rab11 in Complex with Rab11-FIP2
2GZH 2.47 Å, Crystal Structure of Rab11 in Complex with Rab11-Family Interacting Protein 2

Browse structure collections

About this viewer

MolViewer shows 5EZ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.