Crystal Structure of human Ubc9 (K48A/K49A/E54A). Determined by X-ray diffraction at 1.12 Å resolution. Released 27 Apr 2016.
Explore 5F6E in 3D Show helices and sheets RCSB PDB PDBe
5F6E contains 7 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-18 | 16 | |
| β-strand | 25-30 | 6 | 1 |
| β-strand | 36-46 | 11 | 1 |
| α-helix | 47-48 | 2 | |
| β-strand | 57-63 | 7 | 1 |
| α-helix | 72-73 | 2 | |
| β-strand | 74-77 | 4 | 1 |
| β-strand | 86 | 1 | 2 |
| β-strand | 91 | 1 | 1 |
| β-strand | 92 | 1 | 2 |
| α-helix | 95-97 | 3 | |
| α-helix | 109-121 | 13 | |
| α-helix | 131-139 | 9 | |
| α-helix | 141-154 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SUMO-conjugating enzyme UBC9 | A | protein | 157 | Homo sapiens | P63279 (AlphaFold model) |
>5F6E_1 SUMO-conjugating enzyme UBC9 (chains A) SGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGAAGTPWAGGLFKLR MLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLN EPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
Insights Into the Allosteric Inhibition of the SUMO E2 Enzyme Ubc9. Hewitt, W.M., Lountos, G.T., Zlotkowski, K. et al. Angew Chem Int Ed Engl (2016) 55:5703-5707. DOI 10.1002/anie.201511351 · PubMed
Other PDB entries of the same protein (UniProt P63279 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5F6E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.