5F71: Hepatitis A virus cellular receptor 2

Human T-cell immunoglobulin and mucin domain protein 3 (hTIM-3). Determined by X-ray diffraction at 2.4 Å resolution. Released 3 Feb 2016.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,789
Mol. weight: 24.64 kDa
Released: 3 Feb 2016

Explore 5F71 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5F71 contains 7 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	13-15	3	2
β-strand	18	1	3
β-strand	30-34	5	1
β-strand	44-48	5	1
α-helix	56-58	3
β-strand	61-62	2	2
α-helix	67-69	3
β-strand	71	1	3
β-strand	74-76	3	2
α-helix	81-83	3
β-strand	85-91	7	1
β-strand	100-108	9	1

Chain B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	4
β-strand	13-15	3	5
β-strand	18	1	6
α-helix	21-22	2
β-strand	30-34	5	4
β-strand	44-48	5	4
α-helix	56-58	3
β-strand	61-62	2	5
α-helix	67-69	3
β-strand	71	1	6
β-strand	74-76	3	5
α-helix	81-83	3
β-strand	85-91	7	4
β-strand	100-108	9	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hepatitis A virus cellular receptor 2	A, B	protein	109	Homo sapiens	Q8TDQ0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5F71_1 Hepatitis A virus cellular receptor 2 (chains A, B)
SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSR
YWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIK

Primary citation

Crystal structures of human TIM members: Ebolavirus entry-enhancing receptors. Wang, H., Qi, J.X., Liu, N.N. Chin Sci Bull (2015) 60:3438-3453. DOI 10.1360/N972015-01255

Other PDB entries of the same protein (UniProt Q8TDQ0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7M3Z 1.4 Å, Structure of TIM-3 in complex with N-(4-(8-chloro-2-mehtyl-5-oxo-5,6-dihydro-[1,2,4]triaz…
7KQL 1.49 Å, Anti-Tim3 antibody Fab complex
7M3Y 1.69 Å, Structure of TIM-3 in complex with 8-chloro-2-methyl-9-(3-mehtylpyridin-4-yl)-[1,2,4]tria…
6DHB 1.7 Å, Crystal structure of the human TIM-3 with bound Calcium
7M41 1.79 Å, Structure of TIM-3 in complex with N-(4-(8-chloro-2-methyl-5-oxo-5,6-dihydro-[1,2,4]traiz…
8TFT 2.3 Å, Fab of O13-1 human IgG1 antibody bound to IgV domain of human TIM-3
8TBB 2.5 Å, F9S, novel TIM-3 targeting antibody, bound to IgV domain of TIM-3
6TXZ 3.06 Å, FAB part of M6903 in complex with human TIM3
5DZL 3.4 Å, Crystal structure of the protein human CEACAM1
8HGJ 4.82 Å, Toxascaris leonina galectin (Tl-gal) and Human T-cell immunoglobulin mucin-3 (Tim3)…

Browse structure collections

About this viewer

MolViewer shows 5F71 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.