5FAX: Subtilase SubHal from Bacillus halmapalus

Structure of subtilase SubHal from Bacillus halmapalus. Determined by X-ray diffraction at 2.0 Å resolution. Released 18 May 2016.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Bacillus halmapalus
Chains: 2
Atoms: 7,064
Mol. weight: 90.95 kDa
Ligands: CA
Released: 18 May 2016

Explore 5FAX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FAX contains 31 α-helices and 52 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	2-7	6
α-helix	10-17	8
β-strand	25-30	6	1
β-strand	50-55	6	1
α-helix	68-77	10
β-strand	90-95	6	1
β-strand	107	1	2
α-helix	111-119	9
β-strand	124-127	4	1
β-strand	131	1	3
α-helix	139-150	12
β-strand	154-158	5	1
α-helix	169-170	2
β-strand	171	1	3
β-strand	179-184	6	1
α-helix	189-191	3
α-helix	193-195	3
α-helix	200	1
β-strand	201	1	1
α-helix	202	1
β-strand	219-222	4	1
β-strand	226-229	4	4
α-helix	236-238	3
β-strand	241-242	2	4
β-strand	247-250	4	4
α-helix	253-274	22
α-helix	281-291	11
β-strand	293	1	1
β-strand	308	1	1
α-helix	311-315	5
β-strand	318-321	4	5
β-strand	326	1	6
β-strand	331-338	8	7
β-strand	344-349	6	5
α-helix	352-354	3
β-strand	366-372	7	7
β-strand	378-380	3	7
β-strand	398-403	6	5
α-helix	406-407	2
β-strand	409-419	11	7
β-strand	425	1	6
β-strand	428-432	5	5

Chain B: 15 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	2-7	6
α-helix	10-15	6
β-strand	25-30	6	8
β-strand	50-55	6	8
α-helix	68-77	10
β-strand	90-95	6	8
β-strand	107	1	2
α-helix	110-119	10
β-strand	124-127	4	8
β-strand	131	1	9
α-helix	139-150	12
β-strand	154-158	5	8
α-helix	169-170	2
β-strand	171	1	9
β-strand	179-184	6	8
α-helix	185-186	2
α-helix	189-191	3
β-strand	201	1	8
β-strand	219-222	4	8
β-strand	226-229	4	10
α-helix	236-238	3
β-strand	241-242	2	10
β-strand	247-250	4	10
α-helix	253-270	18
α-helix	271-275	5
α-helix	281-291	11
β-strand	293	1	8
β-strand	308	1	8
α-helix	311-315	5
β-strand	318-321	4	11
β-strand	326	1	12
β-strand	331-338	8	13
β-strand	344-349	6	11
α-helix	352-354	3
β-strand	366-372	7	13
β-strand	378-380	3	13
β-strand	398-403	6	11
α-helix	406-407	2
β-strand	409-419	11	13
β-strand	425	1	12
β-strand	428-432	5	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Subtilase SubHal from Bacillus halmapalus	A, B	protein	433	Bacillus halmapalus	A0A182DWC7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5FAX_1 Subtilase SubHal from Bacillus halmapalus (chains A, B)
NDVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTN
NANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSA
GARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAIT
VGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFW
ANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFP
NGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTAS
LTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNV
PVGPQTFSLAIVH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	6

Primary citation

Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family. Dohnalek, J., McAuley, K.E., Brzozowski, A.M. et al. Book (2016):203-266. DOI 10.4032/9789814669337

Other PDB entries of the same protein (UniProt A0A182DWC7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FBZ 1.9 Å, Structure of subtilase SubHal from Bacillus halmapalus - complex with chymotrypsin…

Browse structure collections

About this viewer

MolViewer shows 5FAX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.