5FEB: Sodium channel subunit beta-2

Crystal structure of the Voltage-gated Sodium Channel Beta 2 subunit extracellular domain. Determined by X-ray diffraction at 1.35 Å resolution. Released 9 Mar 2016.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,333
Mol. weight: 14.65 kDa
Released: 9 Mar 2016

Explore 5FEB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FEB contains 4 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	32-33	2	1
β-strand	37-41	5	2
β-strand	46-48	3	3
β-strand	51-52	2	1
β-strand	64-70	7	2
β-strand	78-84	7	2
β-strand	86-89	4	2
α-helix	93-95	3
β-strand	99-101	3	3
β-strand	104	1	1
α-helix	105-107	3
β-strand	109	1	1
β-strand	112-114	3	3
α-helix	119-121	3
β-strand	123-130	8	2
α-helix	137	1
β-strand	138-147	10	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium channel subunit beta-2	A	protein	125	Homo sapiens	O60939 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5FEB_1 Sodium channel subunit beta-2 (chains A)
SNAMEVTVPATLNVLNGSDARLPCTFNSAYTVNHKQFSLNWTYQECNNCSEEMFLQFRMK
IINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQV
LMEEP

Primary citation

Binary architecture of the Nav1.2-beta 2 signaling complex. Das, S., Gilchrist, J., Bosmans, F. et al. Elife (2016) 5. DOI 10.7554/eLife.10960 · PubMed

Other PDB entries of the same protein (UniProt O60939 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VRR 1.45 Å, Crystal structure of a disease mutant of the Voltage-gated Sodium Channel Beta 2 subunit…
5FDY 1.85 Å, Crystal structure of the Voltage-gated Sodium Channel Beta 2 subunit extracellular…
7W9K 2.2 Å, Cryo-EM structure of human Nav1.7-beta1-beta2 complex at 2.2 angstrom resolution
8I5Y 2.6 Å, Structure of human Nav1.7 in complex with vixotrigine
21TQ 2.7 Å, The structure of Nav1.7 with veratridine standing near the IFM motif (site I)
7XVE 2.7 Å, Human Nav1.7 mutant class-I
8I5B 2.7 Å, Structure of human Nav1.7 in complex with bupivacaine
8I5G 2.7 Å, Structure of human Nav1.7 in complex with PF-05089771
8THH 2.7 Å, Cryo-EM structure of Nav1.7 with LTG
7XVF 2.8 Å, Nav1.7 mutant class2
8G1A 2.8 Å, Cryo-EM structure of Nav1.7 with CBD
7W9P 2.9 Å, Cryo-EM structure of human Nav1.7(E406K) in complex with auxiliary beta subunits,…

Browse structure collections

About this viewer

MolViewer shows 5FEB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.