5FFO: Integrin alpha V beta 6

Integrin alpha V beta 6 in complex with pro-TGF-beta. Determined by X-ray diffraction at 3.49 Å resolution. Released 25 Jan 2017.

Method: X-ray diffraction
Resolution: 3.49 Å
Organism: Homo sapiens
Chains: 8
Atoms: 23,786
Mol. weight: 368.62 kDa
Ligands: CA, NAG, MN
Released: 25 Jan 2017

Explore 5FFO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FFO contains 84 α-helices and 210 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 54 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	9-12	4	2
β-strand	23-26	4	3
β-strand	35-40	6	3
β-strand	55-60	6	3
β-strand	67-69	3	3
α-helix	77-78	2
β-strand	79-81	3	4
β-strand	84-85	2	4
β-strand	87-88	2	5
β-strand	97-101	5	6
β-strand	104-109	6	6
β-strand	113-114	2	5
β-strand	123	1	5
β-strand	127-131	5	6
β-strand	136-139	4	6
β-strand	160-163	4	7
β-strand	168-173	6	7
α-helix	176-179	4
β-strand	181	1	8
β-strand	182-187	6	7
α-helix	188-193	6
β-strand	208-209	2	7
α-helix	215-217	3
β-strand	222	1	8
β-strand	225-229	5	9
α-helix	237	1
β-strand	238-243	6	9
α-helix	246-249	4
β-strand	252-256	5	9
β-strand	263-268	6	9
β-strand	279-283	5	10
β-strand	292-297	6	10
β-strand	301-303	3	11
β-strand	309-311	3	11
β-strand	314-320	7	10
β-strand	326-332	7	10
β-strand	343-348	6	12
β-strand	357-362	6	12
α-helix	367-369	3
β-strand	372-376	5	12
β-strand	378-379	2	13
β-strand	382-383	2	13
β-strand	389-392	4	12
β-strand	405-413	9	2
β-strand	422-427	6	2
α-helix	428-430	3
β-strand	432-436	5	2
α-helix	437	1
β-strand	438	1	1
α-helix	439-440	2
β-strand	441-451	11	14
β-strand	454	1	15
β-strand	460	1	16
β-strand	472	1	16
β-strand	473-484	12	14
β-strand	491-500	10	17
β-strand	512-514	3	14
β-strand	521-529	9	17
β-strand	535-543	9	14
α-helix	544-545	2
α-helix	546-548	3
β-strand	556-564	9	17
α-helix	567-569	3
β-strand	578-579	2	14
β-strand	587-591	5	17
β-strand	592	1	15

Chain B: 12 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	116-123	8	18
α-helix	126-128	3
α-helix	132-149	18
β-strand	153-160	8	18
α-helix	173-177	5
α-helix	188-190	3
β-strand	193-200	8	18
α-helix	204-211	8
β-strand	223	1	19
α-helix	225-234	10
β-strand	246-252	7	18
β-strand	257	1	19
α-helix	262-265	4
α-helix	271-272	2
β-strand	278	1	20
β-strand	283	1	18
β-strand	284	1	20
α-helix	291-294	4
α-helix	295-304	10
β-strand	307-313	7	18
α-helix	315-327	13
β-strand	332-335	4	18
α-helix	341-348	8

Chain C: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	9-27	19
α-helix	44-45	2
α-helix	46-55	10
β-strand	77-83	7	21
β-strand	102-107	6	22
α-helix	108-114	7
β-strand	121-127	7	21
β-strand	130	1	23
β-strand	138-145	8	22
β-strand	149-157	9	22
β-strand	168-170	3	21
α-helix	172-180	9
β-strand	185-192	8	22
β-strand	219	1	23
β-strand	228-233	6	21
α-helix	236-239	4
α-helix	253-256	4
β-strand	265-267	3	24
α-helix	268	1
β-strand	270-271	2	25
α-helix	273-276	4
β-strand	282-284	3	26
β-strand	288-289	2	25
β-strand	292-294	3	24
β-strand	327-329	3	27
β-strand	332-341	10	26
β-strand	344-355	12	26
β-strand	358-360	3	27

Chain D: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	12-27	16
α-helix	46-55	10
β-strand	77-83	7	26
β-strand	85	1	28
β-strand	98	1	28
β-strand	101-106	6	28
α-helix	111-114	4
α-helix	118-120	3
β-strand	121-127	7	26
β-strand	130	1	29
β-strand	138-145	8	28
β-strand	149-157	9	28
β-strand	169-170	2	26
α-helix	172-180	9
β-strand	186-192	7	28
β-strand	207	1	29
α-helix	218-223	6
β-strand	228-233	6	26
β-strand	265-267	3	30
α-helix	268	1
β-strand	271	1	31
α-helix	273-276	4
β-strand	282-284	3	21
β-strand	288	1	31
β-strand	292-294	3	30
β-strand	327-329	3	32
β-strand	332-339	8	21
β-strand	346-355	10	21
β-strand	358-360	3	32

Chain E: 14 helices, 52 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	33
β-strand	9-12	4	34
β-strand	22-26	5	35
β-strand	35-40	6	35
β-strand	55-60	6	35
β-strand	67-70	4	35
α-helix	77-78	2
β-strand	79-81	3	36
β-strand	84-85	2	36
β-strand	87-88	2	37
β-strand	97-101	5	38
β-strand	104-109	6	38
β-strand	113-114	2	37
β-strand	123	1	37
β-strand	127-131	5	38
β-strand	136-139	4	38
β-strand	160-163	4	39
β-strand	168-173	6	39
α-helix	176-179	4
β-strand	181	1	40
β-strand	182-187	6	39
α-helix	188-193	6
β-strand	208-209	2	39
α-helix	215-217	3
β-strand	222	1	40
β-strand	225-229	5	41
α-helix	237	1
β-strand	238-243	6	41
α-helix	246-249	4
β-strand	252-256	5	41
β-strand	263-268	6	41
β-strand	279-283	5	42
β-strand	292-297	6	42
β-strand	301-303	3	43
β-strand	309-311	3	43
β-strand	314-320	7	42
β-strand	326-332	7	42
β-strand	343-348	6	44
β-strand	357-362	6	44
α-helix	367-369	3
β-strand	372-376	5	44
β-strand	378-379	2	45
β-strand	382-383	2	45
β-strand	389-392	4	44
α-helix	393	1
β-strand	408-413	6	34
β-strand	422-427	6	34
α-helix	428-430	3
β-strand	432-436	5	34
α-helix	437	1
β-strand	438	1	33
α-helix	439-440	2
β-strand	441-451	11	46
β-strand	460	1	47
β-strand	472	1	47
β-strand	473-484	12	46
β-strand	491-500	10	48
β-strand	512-514	3	46
β-strand	521-529	9	48
β-strand	535-543	9	46
α-helix	544-545	2
α-helix	546-548	3
β-strand	557-564	8	48
α-helix	567-569	3
β-strand	578-579	2	46
β-strand	587-590	4	48

Chain F: 12 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	116-123	8	49
α-helix	126-128	3
α-helix	132-149	18
β-strand	153-160	8	49
α-helix	173-177	5
α-helix	188-190	3
β-strand	193-200	8	49
α-helix	204-211	8
β-strand	223	1	50
α-helix	225-234	10
β-strand	246-252	7	49
β-strand	257	1	50
α-helix	262-264	3
α-helix	271-272	2
β-strand	278	1	51
β-strand	283	1	49
β-strand	284	1	51
α-helix	291-294	4
α-helix	295-302	8
β-strand	307-313	7	49
α-helix	315-327	13
β-strand	332-335	4	49
α-helix	341-348	8

Chain G: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	11-27	17
α-helix	43-45	3
α-helix	46-55	10
β-strand	77-83	7	52
β-strand	102-107	6	53
α-helix	108-114	7
β-strand	121-127	7	52
β-strand	130	1	54
β-strand	138-145	8	53
β-strand	149-157	9	53
β-strand	168-170	3	52
α-helix	172-180	9
β-strand	185-192	8	53
β-strand	219	1	54
β-strand	228-233	6	52
α-helix	236-239	4
α-helix	253-256	4
β-strand	265-267	3	55
α-helix	268	1
β-strand	270-271	2	56
β-strand	282-284	3	57
β-strand	288-289	2	56
β-strand	292-294	3	55
β-strand	327-329	3	58
β-strand	332-341	10	57
β-strand	344-355	12	57
β-strand	358-360	3	58

Chain H: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	11-27	17
α-helix	46-55	10
β-strand	77-83	7	57
β-strand	85	1	59
β-strand	98	1	59
β-strand	101-106	6	59
α-helix	111-114	4
α-helix	118-120	3
β-strand	121-127	7	57
β-strand	130	1	60
β-strand	138-145	8	59
β-strand	149-157	9	59
β-strand	168-170	3	57
α-helix	172-180	9
β-strand	186-192	7	59
β-strand	195	1	61
β-strand	200	1	61
β-strand	207	1	60
α-helix	218-223	6
β-strand	228-233	6	57
β-strand	265-267	3	62
α-helix	268	1
β-strand	271	1	63
α-helix	273-276	4
β-strand	282-284	3	52
β-strand	288	1	63
β-strand	292-294	3	62
β-strand	327-329	3	64
β-strand	332-339	8	52
β-strand	346-355	10	52
β-strand	358-360	3	64

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-V	A, E	protein	601	Homo sapiens	P06756 (AlphaFold model)
Integrin beta-6	B, F	protein	257	Homo sapiens	P18564 (AlphaFold model)
Transforming growth factor beta-1	C, D, G, H	protein	363	Homo sapiens	P01137 (AlphaFold model)

Sequence of entity 1 (A, E), FASTA

>5FFO_1 Integrin alpha-V (chains A, E)
FNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCD
WSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQ
EREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQ
GQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFV
SGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLF
MDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAI
AAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSGCPPSFGYSMKGATDIDKNGY
PDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCL
KADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELI
AYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDTGGL
E

Sequence of entity 2 (B, F), FASTA

>5FFO_2 Integrin beta-6 (chains B, F)
TEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVK
TTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIM
QAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVCPNDGLCHLDSKNEYSMSTVL
EYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISA
YEELRSEVELEHHHHHH

Sequence of entity 3 (C, D, G, H), FASTA

>5FFO_3 Transforming growth factor beta-1 (chains C, D, G, H)
GPLSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDR
VAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFQTSELREAVPEP
VLLSRAELRLLRLKLKVEQHVELYQKYSQNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQW
LSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLER
AQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCP
YIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSC
KCS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	8
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4
MN	Manganese (II) ion	Mn	6

Primary citation

Force interacts with macromolecular structure in activation of TGF-beta. Dong, X., Zhao, B., Iacob, R.E. et al. Nature (2017) 542:55-59. DOI 10.1038/nature21035 · PubMed

Other PDB entries of the same protein (UniProt P06756 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CZD 2.23 Å, Crystal structure of integrin avb6 headpiece in complex with compound 30
5FFG 2.25 Å, Crystal structure of integrin alpha V beta 6 head
8W30 2.45 Å, Crystal structure of alpha-V beta-1 integrin headpiece in complex with TR01225179
9CZA 2.49 Å, Crystal structure of integrin avb6 headpiece in complex with compound 18
4UM9 2.5 Å, Crystal structure of alpha V beta 6 with peptide
9CZF 2.53 Å, Crystal structure of integrin avb6 headpiece in complex with compound MORF-627
9CZ7 2.57 Å, Crystal structure of integrin avb6 headpiece in complex with compound 12
6OM1 2.66 Å, Crystal structure of an atypical integrin
8VS6 2.73 Å, L-TGF-b3/avb8
6OM2 2.77 Å, Crystal structure of atypical integrin alphaV beta8 with proTGF-beta1 ligand peptide
9IUJ 2.78 Å, Integrin alpha-v beta-3 in complex with rhodostomin
9LT3 2.79 Å, Integrin alpha-v beta-3 in complex with Trimucrin

Browse structure collections

About this viewer

MolViewer shows 5FFO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.