5FTI: GluA2 K738M-T744K LBD

Crystal structure of the GluA2 K738M-T744K LBD in complex with glutamate (lithium form). Determined by X-ray diffraction at 1.35 Å resolution. Released 3 Feb 2016.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: RATTUS NORVEGICUS
Chains: 2
Atoms: 4,885
Mol. weight: 65.4 kDa
Ligands: GLU, LI
Released: 3 Feb 2016

Explore 5FTI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FTI contains 32 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	393-394	2
β-strand	395-399	5	1
β-strand	407-408	2	2
α-helix	412-414	3
α-helix	417-420	4
β-strand	421-422	2	2
α-helix	424-436	13
β-strand	440-444	5	1
β-strand	453	1	3
β-strand	460	1	3
α-helix	462-468	7
β-strand	474-475	2	1
β-strand	480	1	4
α-helix	483-486	4
β-strand	489-491	3	1
α-helix	492	1
α-helix	494	1
β-strand	496-498	3	4
β-strand	500-505	6	5
α-helix	636-640	5
β-strand	646-649	4	5
β-strand	650	1	6
α-helix	654-661	8
α-helix	665-676	12
β-strand	683	1	6
α-helix	686-695	10
β-strand	700-705	6	5
α-helix	706-713	8
β-strand	720-723	4	5
β-strand	730-732	3	4
β-strand	735-737	3	1
α-helix	743-756	14
α-helix	758-763	6
α-helix	764-768	5

Chain B: 16 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	395-399	5	7
β-strand	402	1	8
β-strand	406	1	8
β-strand	407-408	2	9
α-helix	409	1
α-helix	412-414	3
α-helix	417-420	4
β-strand	421-422	2	9
α-helix	424-436	13
β-strand	440-444	5	7
β-strand	453	1	10
β-strand	460	1	10
α-helix	462-468	7
β-strand	474-475	2	7
β-strand	480	1	11
α-helix	483-486	4
β-strand	489-491	3	7
α-helix	492	1
α-helix	494	1
β-strand	496-498	3	11
β-strand	500-505	6	12
α-helix	636-640	5
β-strand	646-648	3	12
β-strand	650	1	13
α-helix	654-661	8
α-helix	665-676	12
β-strand	683	1	13
α-helix	686-695	10
β-strand	700-705	6	12
α-helix	706-713	8
β-strand	720-723	4	12
β-strand	730-732	3	11
β-strand	735-737	3	7
α-helix	743-755	13
α-helix	758-763	6
α-helix	764-768	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate receptor 2	A, B	protein	291	RATTUS NORVEGICUS	P19491 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5FTI_1 GLUTAMATE RECEPTOR 2 (chains A, B)
MHHHHHHHHSSGLVPRGSAMGSGNDTSRGANKTVVVTTILESPYVMMKKNHEMLEGNERY
EGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTI
TLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKI
AVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVG
GNLDSKGYGIATPMGSSLGKPVNLAVLKLSEQGVLDKLKNKWWYDKGECGA

Ligands and cofactors

ID	Name	Formula	Copies
GLU	Glutamic acid	C5 H9 N O4	2
LI	Lithium ion	Li	2

Water and common crystallization additives (SO4, GOL) are not listed.

Primary citation

Distinct Structural Pathways Coordinate the Activation of Ampa Receptor-Auxiliary Subunit Complexes. Dawe, G.B., Musgaard, M., Aurousseau, M.R.P. et al. Neuron (2016) 89:1264. DOI 10.1016/J.NEURON.2016.01.038 · PubMed

Other PDB entries of the same protein (UniProt P19491 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YK4 1.0 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
5NG9 1.15 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with agonist…
6YK5 1.15 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
6YK3 1.2 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
5JEI 1.23 Å, Crystal structure of the GluA2 LBD in complex with FW
4IGT 1.24 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with the agonist…
4YU0 1.26 Å, Crystal structure of a tetramer of GluA2 TR mutant ligand binding domains bound with…
5NIH 1.3 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with agonist…
1MQI 1.35 Å, Crystal Structure of the GluR2 Ligand Binding Core (S1S2J) in Complex with…
4U21 1.39 Å, GluA2flip sLBD complexed with FW and (R,R)-2b crystal form E
4FAT 1.4 Å, Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an…
6FAZ 1.4 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with the…

Browse structure collections

About this viewer

MolViewer shows 5FTI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.