5FWX: Glutamate receptor 2

Crystal structure of the AMPA receptor GluA2/A4 N-terminal domain heterodimer. Determined by X-ray diffraction at 2.5 Å resolution. Released 16 Mar 2016.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: RATTUS NORVEGICUS
Chains: 4
Atoms: 11,343
Mol. weight: 177.61 kDa
Ligands: NAG
Released: 16 Mar 2016

Explore 5FWX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FWX contains 51 α-helices and 81 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	1
α-helix	17-30	14
β-strand	37-44	8	1
α-helix	49-62	14
β-strand	66-69	4	1
α-helix	76-86	11
β-strand	89-92	4	1
α-helix	95-97	3
β-strand	104-106	3	1
α-helix	109-110	2
α-helix	112-122	11
β-strand	126-131	6	2
α-helix	138-149	12
β-strand	153-158	6	2
α-helix	174-181	8
β-strand	185-189	5	2
α-helix	192-202	11
β-strand	213-216	4	2
β-strand	220	1	2
β-strand	235-240	6	2
α-helix	247-256	10
α-helix	274-295	22
α-helix	320-328	9
β-strand	331-334	4	3
β-strand	337-340	4	3
β-strand	341	1	4
β-strand	347	1	4
β-strand	351-357	7	2
β-strand	362-369	8	2
β-strand	373-376	4	2

Chain B: 14 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	5
α-helix	17-32	16
β-strand	42-49	8	5
α-helix	55-67	13
β-strand	72-75	4	5
α-helix	82-92	11
α-helix	94	1
β-strand	95-98	4	5
β-strand	110-112	3	5
α-helix	118-128	11
β-strand	132-137	6	6
β-strand	140	1	7
β-strand	142	1	7
α-helix	144-155	12
β-strand	159-164	6	6
α-helix	170-182	13
β-strand	187-191	5	6
α-helix	194-207	14
β-strand	211	1	8
β-strand	215-218	4	6
β-strand	222	1	6
α-helix	223-225	3
α-helix	229-234	6
β-strand	235	1	8
β-strand	237-242	6	6
α-helix	249-258	10
α-helix	272-274	3
α-helix	275-296	22
α-helix	321-328	8
β-strand	332-335	4	9
β-strand	338-341	4	9
β-strand	342	1	10
β-strand	347	1	5
β-strand	348	1	10
β-strand	352-359	8	6
β-strand	362-370	9	6
β-strand	374-377	4	6

Chain C: 12 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	11
α-helix	17-30	14
β-strand	37-44	8	11
α-helix	49-62	14
β-strand	66-69	4	11
α-helix	76-86	11
β-strand	90-92	3	11
α-helix	95-97	3
β-strand	104-106	3	11
α-helix	109-110	2
α-helix	112-122	11
β-strand	126-131	6	12
α-helix	138-149	12
β-strand	153-158	6	12
α-helix	175-181	7
β-strand	185-189	5	12
α-helix	192-202	11
β-strand	213-216	4	12
β-strand	220	1	12
β-strand	235-240	6	12
α-helix	247-256	10
α-helix	274-295	22
α-helix	320-329	10
β-strand	332-334	3	13
β-strand	337-339	3	13
β-strand	341	1	14
β-strand	347	1	14
β-strand	351-357	7	12
β-strand	362-369	8	12
β-strand	373-376	4	12

Chain D: 13 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	15
α-helix	17-32	16
β-strand	42-49	8	15
α-helix	55-67	13
β-strand	72-75	4	15
α-helix	82-92	11
β-strand	95-98	4	15
β-strand	110-112	3	15
α-helix	118-128	11
β-strand	132-137	6	16
β-strand	140	1	17
β-strand	142	1	17
α-helix	144-155	12
β-strand	159-164	6	16
α-helix	170-182	13
β-strand	187-191	5	16
α-helix	194-207	14
β-strand	211	1	18
β-strand	215-218	4	16
β-strand	222	1	16
α-helix	223-225	3
α-helix	229-234	6
β-strand	235	1	18
β-strand	237-242	6	16
α-helix	249-258	10
α-helix	272-274	3
α-helix	275-297	23
α-helix	321-328	8
β-strand	332-335	4	19
β-strand	338-341	4	19
β-strand	342	1	20
β-strand	348	1	20
β-strand	352-359	8	16
β-strand	362-370	9	16
β-strand	374-377	4	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate receptor 2	A, C	protein	385	RATTUS NORVEGICUS	P19491 (AlphaFold model)
Glutamate receptor 4	B, D	protein	389	RATTUS NORVEGICUS	P19493 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5FWX_1 GLUTAMATE RECEPTOR 2 (chains A, C)
NSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRG
VYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQ
WDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQDLELKKE
RRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVD
YDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRR
GNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPR
KIGYWSEVDKMVVTLTRTKHHHHHH

Sequence of entity 2 (B, D), FASTA

>5FWX_2 GLUTAMATE RECEPTOR 4 (chains B, D)
AFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTN
AFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGA
LLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEEL
DRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTG
FQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKID
ISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKS
TGPRKVGYWNDMDKLVLIQDRTKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure and Organization of Heteromeric Ampa-Type Glutamate Receptors. Herguedas, B., Garcia-Nafria, J., Cais, O. et al. Science (2016) 352:3873. DOI 10.1126/SCIENCE.AAD3873 · PubMed

Other PDB entries of the same protein (UniProt P19491 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YK4 1.0 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
5NG9 1.15 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with agonist…
6YK5 1.15 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
6YK3 1.2 Å, Structure of the AMPA receptor GluA2o ligand-binding domain (S1S2J) in complex with the…
5JEI 1.23 Å, Crystal structure of the GluA2 LBD in complex with FW
4IGT 1.24 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with the agonist…
4YU0 1.26 Å, Crystal structure of a tetramer of GluA2 TR mutant ligand binding domains bound with…
5NIH 1.3 Å, Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with agonist…
1MQI 1.35 Å, Crystal Structure of the GluR2 Ligand Binding Core (S1S2J) in Complex with…
5FTI 1.35 Å, Crystal structure of the GluA2 K738M-T744K LBD in complex with glutamate (lithium form)
4U21 1.39 Å, GluA2flip sLBD complexed with FW and (R,R)-2b crystal form E
4FAT 1.4 Å, Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an…

Browse structure collections

About this viewer

MolViewer shows 5FWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.