Ligand complex of RORg LBD. Determined by X-ray diffraction at 1.72 Å resolution. Released 3 Aug 2016.
Explore 5G42 in 3D Show helices and sheets RCSB PDB PDBe
5G42 contains 19 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 260-262 | 3 | |
| α-helix | 267-282 | 16 | |
| α-helix | 289-294 | 6 | |
| α-helix | 295-297 | 3 | |
| β-strand | 299 | 1 | 1 |
| α-helix | 302-310 | 9 | |
| α-helix | 313-337 | 25 | |
| α-helix | 341-343 | 3 | |
| α-helix | 346-364 | 19 | |
| α-helix | 365-368 | 4 | |
| β-strand | 369-370 | 2 | 1 |
| β-strand | 375-378 | 4 | 1 |
| β-strand | 381-383 | 3 | 1 |
| α-helix | 385-391 | 7 | |
| α-helix | 394-408 | 15 | |
| α-helix | 414-425 | 12 | |
| α-helix | 436-456 | 21 | |
| α-helix | 460-465 | 6 | |
| α-helix | 467-468 | 2 | |
| α-helix | 471-489 | 19 | |
| α-helix | 491-497 | 7 | |
| α-helix | 500-506 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 689-695 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nuclear receptor ror-gamma | A | protein | 266 | HOMO SAPIENS | P51449 (AlphaFold model) |
| Rorg | C | protein | 10 | HOMO SAPIENS | Q15596 (AlphaFold model) |
>5G42_1 NUCLEAR RECEPTOR ROR-GAMMA (chains A) HNHNHNHNHNHNGGENLYFQGASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSRE EVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLV RMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTAL VLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERL QIFQHLHPIVVQAAFPPLYKELFSGG
>5G42_2 RORG (chains C) KILHRLLQDS
| ID | Name | Formula | Copies |
|---|---|---|---|
| 4TU | 5-chloranyl-2,3-dihydroindole-1-carboxamide | C9 H9 Cl N2 O | 1 |
Water and common crystallization additives (NA) are not listed.
Fragment Screening of Rorgammat Using Cocktail Crystallography: Identification of Simultaneous Binding of Multiple Fragments. Xue, Y., Guo, H., Hillertz, P. ChemMedChem (2016) 11:1881. DOI 10.1002/CMDC.201600242 · PubMed
Other PDB entries of the same protein (UniProt P51449 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5G42 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.