5G4P: Human hippocalcin

Crystal structure of human hippocalcin at 2.4 A resolution. Determined by X-ray diffraction at 2.42 Å resolution. Released 3 May 2017.

Method: X-ray diffraction
Resolution: 2.42 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,012
Mol. weight: 45.15 kDa
Ligands: CA
Released: 3 May 2017

Explore 5G4P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5G4P contains 21 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	10-18	9
α-helix	24-37	14
β-strand	42-44	3	1
α-helix	45-53	9
α-helix	58-72	15
β-strand	79-81	3	1
α-helix	82-94	13
α-helix	97-108	12
β-strand	116-117	2	2
α-helix	118-132	15
α-helix	145-153	9
β-strand	163-164	2	2
α-helix	166-173	8
α-helix	177-183	7

Chain E: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	10-19	10
α-helix	24-37	14
β-strand	43	1	3
α-helix	45-52	8
α-helix	62-72	11
β-strand	80	1	3
α-helix	82-94	13
α-helix	97-108	12
β-strand	115-117	3	4
α-helix	118-132	15
α-helix	145-156	12
β-strand	163-165	3	4
α-helix	166-173	8
α-helix	177-183	7
α-helix	187-189	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuron-specific calcium-binding protein hippocalcin	A, E	protein	193	Homo sapiens	P84074 (AlphaFold model)

Sequence of entity 1 (A, E), FASTA

>5G4P_1 Neuron-specific calcium-binding protein hippocalcin (chains A, E)
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGD
ASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV
RLLQCDPSSASQF

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	6

Primary citation

Biophysical and functional characterization of hippocalcin mutants responsible for human dystonia. Helassa, N., Antonyuk, S.V., Lian, L.Y. et al. Hum Mol Genet (2017) 26:2426-2435. DOI 10.1093/hmg/ddx133 · PubMed

Other PDB entries of the same protein (UniProt P84074 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OWM 1.5 Å, HsNMT1 in complex with both MyrCoA and HCPA substrate peptide GKQNSKLR
5G58 2.54 Å, Crystal structure of A190T mutant of human hippocalcin AT 2.5 A resolution
5M6C 3.0 Å, Crystal structure of T71N mutant of human hippocalcin

Browse structure collections

About this viewer

MolViewer shows 5G4P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.