5GCN: Histone acetyltransferase GCN5

Name: PDB 5GCN: Catalytic domain of tetrahymena GCN5 histone acetyltransferase in complex with coenzyme a
Published: 1999-07-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Catalytic domain of tetrahymena GCN5 histone acetyltransferase in complex with coenzyme a. Determined by solution NMR. Released 19 Jul 1999.

Method: Solution NMR
Organism: Tetrahymena thermophila
Chains: 1
Atoms: 1,435
Mol. weight: 20.5 kDa
Ligands: COA
Released: 19 Jul 1999

Explore 5GCN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GCN contains 6 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
α-helix	17-32	16
α-helix	38-45	8
β-strand	51-56	6	1
β-strand	62-70	9	1
β-strand	76	1	2
β-strand	77-82	6	1
α-helix	86-88	3
α-helix	94-107	14
β-strand	112	1	2
β-strand	115-116	2	3
α-helix	119-128	10
β-strand	131	1	4
α-helix	138-141	4
β-strand	153-154	2	3
β-strand	155	1	4
β-strand	157	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase GCN5	A	protein	166	Tetrahymena thermophila	Q27198 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5GCN_1 HISTONE ACETYLTRANSFERASE GCN5 (chains A)
MKGLLDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQ
KVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNF
AIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGN

Ligands and cofactors

ID	Name	Formula	Copies
COA	Coenzyme a	C21 H36 N7 O16 P3 S	1

Primary citation

Solution structure of the catalytic domain of GCN5 histone acetyltransferase bound to coenzyme A. Lin, Y., Fletcher, C.M., Zhou, J. et al. Nature (1999) 400:86-89. DOI 10.1038/21922 · PubMed

Other PDB entries of the same protein (UniProt Q27198 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QST 1.7 Å, Crystal structure of tetrahymena GCN5
1QSR 2.0 Å, Crystal structure of tetrahymena GCN5 with bound acetyl-coenzyme a
1M1D 2.2 Å, Tetrahymena GCN5 with bound bisubstrate analog inhibitor
1QSN 2.2 Å, Crystal structure of tetrahymena GCN5 with bound coenzyme a and histone H3 peptide
1Q2C 2.25 Å, Crystal Structure of Tetrahymena GCN5 With Bound Coenzyme A and a 19-residue Histone H4…
1Q2D 2.25 Å, Crystal Structure of Tetrahymena GCN5 With Bound Coenzyme A and a 19-residue p53 peptide
1PU9 2.3 Å, Crystal Structure of Tetrahymena GCN5 with Bound Coenzyme A and a 19-residue Histone H3…
1PUA 2.3 Å, Crystal Structure of Tetrahymena GCN5 with Bound Coenzyme A and a Phosphorylated,…

Browse structure collections

About this viewer

MolViewer shows 5GCN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.