5GJH: Gads SH2 domain/CD28-derived peptide complex

Gads SH2 domain/CD28-derived peptide complex. Determined by X-ray diffraction at 1.2 Å resolution. Released 14 Dec 2016.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,080
Mol. weight: 25.84 kDa
Released: 14 Dec 2016

Explore 5GJH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GJH contains 4 α-helices and 18 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	59	1	1
α-helix	65-73	9
β-strand	80-84	5	1
β-strand	92-97	6	1
β-strand	102-107	6	1
β-strand	108-109	2	2
β-strand	115-116	2	2
β-strand	121-122	2	2
α-helix	125-134	10

Chain C: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	59	1	3
α-helix	65-73	9
β-strand	79	1	4
β-strand	80-84	5	3
β-strand	92-97	6	3
β-strand	102-107	6	3
β-strand	108-109	2	5
β-strand	115-116	2	5
β-strand	121-122	2	5
α-helix	125-134	10
β-strand	146	1	4

Chain D: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	191	1	6
β-strand	194	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GRB2-related adapter protein 2	A, C	protein	100	Homo sapiens	O75791 (AlphaFold model)
T-cell-specific surface glycoprotein CD28	B, D	protein	8	Homo sapiens	P10747 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5GJH_1 GRB2-related adapter protein 2 (chains A, C)
GSWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNY
FLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGH

Sequence of entity 2 (B, D), FASTA

>5GJH_2 T-cell-specific surface glycoprotein CD28 (chains B, D)
SDYMNMTP

Primary citation

Crystal Structures and Thermodynamic Analysis Reveal Distinct Mechanisms of CD28 Phosphopeptide Binding to the Src Homology 2 (SH2) Domains of Three Adaptor Proteins. Inaba, S., Numoto, N., Ogawa, S. et al. J Biol Chem (2017) 292:1052-1060. DOI 10.1074/jbc.M116.755173 · PubMed

Browse structure collections

About this viewer

MolViewer shows 5GJH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.