5GJK: BAF47 and BAF155 Complex

Crystal Structure of BAF47 and BAF155 Complex. Determined by X-ray diffraction at 2.05 Å resolution. Released 7 Jun 2017.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,454
Mol. weight: 19.34 kDa
Ligands: PO4
Released: 7 Jun 2017

Explore 5GJK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GJK contains 8 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	452-454	3
α-helix	464-469	6
α-helix	471-473	3
α-helix	483-499	17
α-helix	507-511	5
β-strand	517	1	1
α-helix	518-530	13

Chain B: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	186-195	10	1
β-strand	198-207	10	1
α-helix	215-226	12
α-helix	230-247	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SWI/SNF complex subunit SMARCC1	A	protein	94	Homo sapiens	Q92922 (AlphaFold model)
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1	B	protein	68	Homo sapiens	Q12824 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5GJK_1 SWI/SNF complex subunit SMARCC1 (chains A)
NHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYL
TSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVD

Sequence of entity 2 (B), FASTA

>5GJK_2 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (chains B)
APEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAI
RQQIESYP

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structural Insights into BAF47 and BAF155 Complex Formation. Yan, L., Xie, S., Du, Y. et al. J Mol Biol (2017) 429:1650-1660. DOI 10.1016/j.jmb.2017.04.008 · PubMed

Other PDB entries of the same protein (UniProt Q92922 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YXP 1.6 Å, Higher resolution structure of the N-terminal module of the human SWI/SNF-subunit…
6YXO 2.0 Å, Structure of the N-terminal module of the human SWI/SNF-subunit BAF155/SMARCC1
6KZ7 2.28 Å, The crystal structure of BAF155 SWIRM domain and N-terminal elongated hSNF5 RPT1 domain…
2YUS Solution structure of the SANT domain of human SWI/SNF-related matrix-associated…
9A0K A structural model of the endogenoushuman SWI/SNF (BAF) complex bound to the nucleosome…

Browse structure collections

About this viewer

MolViewer shows 5GJK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.