5GLT: Tl-gal with LNT

Tl-gal with LNT. Determined by X-ray diffraction at 2.0 Å resolution. Released 9 Nov 2016.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Toxascaris leonina
Chains: 2
Atoms: 5,008
Mol. weight: 66.77 kDa
Released: 9 Nov 2016

Explore 5GLT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GLT contains 4 α-helices and 52 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	1
β-strand	24-30	7	2
β-strand	37-43	7	1
β-strand	54-61	8	1
β-strand	66-73	8	1
β-strand	76-77	2	1
β-strand	81-84	4	1
β-strand	93-99	7	2
β-strand	103-108	6	2
β-strand	111-117	7	2
α-helix	122-124	3
β-strand	127-132	6	1
β-strand	135-142	8	2
β-strand	146	1	3
β-strand	150-153	4	4
β-strand	159	1	5
β-strand	164-171	8	3
β-strand	177-183	7	4
β-strand	189-196	8	4
β-strand	201-208	8	4
β-strand	211-212	2	4
β-strand	216	1	4
β-strand	229-235	7	3
β-strand	239-244	6	3
β-strand	247-253	7	3
β-strand	261	1	5
β-strand	263-268	6	4
β-strand	270-277	8	3

Chain B: 2 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	6
β-strand	24-30	7	7
β-strand	37-43	7	6
β-strand	54-61	8	6
β-strand	66-73	8	6
β-strand	76-77	2	6
β-strand	81-84	4	6
β-strand	93-99	7	7
β-strand	103-108	6	7
β-strand	111-117	7	7
α-helix	122-124	3
β-strand	127-132	6	6
β-strand	135-142	8	7
β-strand	146	1	8
β-strand	150-153	4	9
β-strand	164-171	8	8
β-strand	177-183	7	9
β-strand	189-196	8	9
β-strand	201-208	8	9
β-strand	211-212	2	9
β-strand	216	1	9
β-strand	229-235	7	8
β-strand	239-244	6	8
β-strand	247-253	7	8
β-strand	263-268	6	9
β-strand	270-277	8	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Galectin	A, B	protein	284	Toxascaris leonina	A0A1L1QJZ7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5GLT_1 Galectin (chains A, B)
HHHHHHMATETNYPVPYRSKLTEPFEPGQTLIIKGKTAEDSVRFTINLHNTSADFSGNDV
PLHISVRFDEGKIVFNTFSKGEWGKEERKSNPYKKGDDIDIRIRAHDSKFSISVDQKEVK
EYEHRVPLSSVTHFSVDGDILITYIHWGGKYYPVPYESGLAGDGLAPGKSLLIFATPEKK
GKRFHINLLKKNGDIALHFNPRFDEKAIVRNSLISGEWGNEEREGKNPLEKGIGCDLEFR
NEEYAFQIYVDGERFATYAHRLDPHDINGLQIGGDVEVTGIQMV

Primary citation

Structural Basis for Carbohydrate Recognition and Anti-inflammatory Modulation by Gastrointestinal Nematode Parasite Toxascaris leonina Galectin. Hwang, E.Y., Jeong, M.S., Park, S.K. et al. J Biol Chem (2016) 291:25326-25338. DOI 10.1074/jbc.M116.743773 · PubMed

Other PDB entries of the same protein (UniProt A0A1L1QJZ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GM0 1.7 Å, Tl-gal with lactose
5GLV 1.8 Å, Tl-gal
5GLW 2.0 Å, Tl-gal with LacNAc
5GLZ 2.0 Å, Tl-gal with Glucose
5GLU 2.1 Å, Tl-gal with SiaLac
8YZQ 2.15 Å, Toxascaris leonina galectin (Tl-gal) W77F/W212F oligomer
8ZQI 2.98 Å, Glucose bound Toxascaris leonina galectin (Tl-gal) W77F/W212F
8HGJ 4.82 Å, Toxascaris leonina galectin (Tl-gal) and Human T-cell immunoglobulin mucin-3 (Tim3)…

Browse structure collections

About this viewer

MolViewer shows 5GLT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.