Tl-gal with LacNAc. Determined by X-ray diffraction at 2.0 Å resolution. Released 9 Nov 2016.
Explore 5GLW in 3D Show helices and sheets RCSB PDB PDBe
5GLW contains 6 α-helices and 50 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8 | 1 | |
| β-strand | 11-14 | 4 | 1 |
| β-strand | 24-30 | 7 | 2 |
| β-strand | 37-43 | 7 | 1 |
| β-strand | 54-61 | 8 | 1 |
| β-strand | 66-73 | 8 | 1 |
| β-strand | 76-77 | 2 | 1 |
| β-strand | 81-84 | 4 | 1 |
| α-helix | 87-88 | 2 | |
| β-strand | 92-99 | 8 | 2 |
| β-strand | 103-108 | 6 | 2 |
| β-strand | 111-117 | 7 | 2 |
| α-helix | 122-124 | 3 | |
| β-strand | 127-132 | 6 | 1 |
| β-strand | 135-142 | 8 | 2 |
| β-strand | 146 | 1 | 3 |
| β-strand | 150-153 | 4 | 4 |
| β-strand | 164-171 | 8 | 3 |
| β-strand | 177-183 | 7 | 4 |
| β-strand | 189-196 | 8 | 4 |
| β-strand | 201-208 | 8 | 4 |
| β-strand | 211-212 | 2 | 4 |
| β-strand | 216 | 1 | 4 |
| β-strand | 229-235 | 7 | 3 |
| β-strand | 239-244 | 6 | 3 |
| β-strand | 247-253 | 7 | 3 |
| β-strand | 263-268 | 6 | 4 |
| β-strand | 270-277 | 8 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8 | 1 | |
| β-strand | 11-14 | 4 | 5 |
| β-strand | 24-30 | 7 | 6 |
| β-strand | 37-43 | 7 | 5 |
| β-strand | 54-61 | 8 | 5 |
| β-strand | 66-73 | 8 | 5 |
| β-strand | 76-77 | 2 | 5 |
| β-strand | 81-84 | 4 | 5 |
| β-strand | 92-99 | 8 | 6 |
| β-strand | 103-108 | 6 | 6 |
| β-strand | 111-117 | 7 | 6 |
| α-helix | 122-124 | 3 | |
| β-strand | 127-132 | 6 | 5 |
| β-strand | 135-142 | 8 | 6 |
| β-strand | 146 | 1 | 7 |
| β-strand | 150-153 | 4 | 8 |
| β-strand | 164-171 | 8 | 7 |
| β-strand | 177-184 | 8 | 8 |
| β-strand | 189-196 | 8 | 8 |
| α-helix | 197-199 | 3 | |
| β-strand | 201-208 | 8 | 8 |
| β-strand | 211-212 | 2 | 8 |
| β-strand | 216 | 1 | 8 |
| β-strand | 229-235 | 7 | 7 |
| β-strand | 239-244 | 6 | 7 |
| β-strand | 247-253 | 7 | 7 |
| β-strand | 261-268 | 8 | 8 |
| β-strand | 270-277 | 8 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| galectin | A, B | protein | 284 | Toxascaris leonina | A0A1L1QJZ7 (AlphaFold model) |
>5GLW_1 galectin (chains A, B) HHHHHHMATETNYPVPYRSKLTEPFEPGQTLIIKGKTAEDSVRFTINLHNTSADFSGNDV PLHISVRFDEGKIVFNTFSKGEWGKEERKSNPYKKGDDIDIRIRAHDSKFSISVDQKEVK EYEHRVPLSSVTHFSVDGDILITYIHWGGKYYPVPYESGLAGDGLAPGKSLLIFATPEKK GKRFHINLLKKNGDIALHFNPRFDEKAIVRNSLISGEWGNEEREGKNPLEKGIGCDLEFR NEEYAFQIYVDGERFATYAHRLDPHDINGLQIGGDVEVTGIQMV
Structural Basis for Carbohydrate Recognition and Anti-inflammatory Modulation by Gastrointestinal Nematode Parasite Toxascaris leonina Galectin. Hwang, E.Y., Jeong, M.S., Park, S.K. et al. J Biol Chem (2016) 291:25326-25338. DOI 10.1074/jbc.M116.743773 · PubMed
Other PDB entries of the same protein (UniProt A0A1L1QJZ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5GLW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.