Importin and NuMA complex. Determined by X-ray diffraction at 2.39 Å resolution. Released 4 Oct 2017.
Explore 5GXW in 3D Show helices and sheets RCSB PDB PDBe
5GXW contains 33 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 78-86 | 9 | |
| α-helix | 90-104 | 15 | |
| α-helix | 112-117 | 6 | |
| α-helix | 121-128 | 8 | |
| α-helix | 134-148 | 15 | |
| α-helix | 152-160 | 9 | |
| α-helix | 163-170 | 8 | |
| α-helix | 176-190 | 15 | |
| α-helix | 194-202 | 9 | |
| α-helix | 206-211 | 6 | |
| α-helix | 218-220 | 3 | |
| α-helix | 223-236 | 14 | |
| α-helix | 243-245 | 3 | |
| α-helix | 246-259 | 14 | |
| α-helix | 265-279 | 15 | |
| α-helix | 283-290 | 8 | |
| α-helix | 295-302 | 8 | |
| α-helix | 307-320 | 14 | |
| α-helix | 325-333 | 9 | |
| α-helix | 336-339 | 4 | |
| α-helix | 340-343 | 4 | |
| α-helix | 349-362 | 14 | |
| α-helix | 367-375 | 9 | |
| α-helix | 379-387 | 9 | |
| α-helix | 391-407 | 17 | |
| α-helix | 410-418 | 9 | |
| α-helix | 422-428 | 7 | |
| α-helix | 434-452 | 19 | |
| α-helix | 457-466 | 10 | |
| α-helix | 469-475 | 7 | |
| α-helix | 476-478 | 3 | |
| α-helix | 482-495 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1987-1988 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Importin subunit alpha-1 | A | protein | 428 | Mus musculus | P52293 (AlphaFold model) |
| Peptide from Nuclear mitotic apparatus protein 1 | B | protein | 27 | Homo sapiens | Q14980 (AlphaFold model) |
>5GXW_1 Importin subunit alpha-1 (chains A) NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG KTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI AGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAV EQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPI VTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLL SAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASL NLIEKYFS
>5GXW_2 Peptide from Nuclear mitotic apparatus protein 1 (chains B) RQQRKRVSLEPHQGPGTPESKKATSCF
Regulation of mitotic spindle assembly factor NuMA by Importin-beta. Chang, C.-C., Huang, T.-L., Shimamoto, Y. et al. J Cell Biol (2017) 216:3453-3462. DOI 10.1083/jcb.201705168 · PubMed
Other PDB entries of the same protein (UniProt P52293 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5GXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.