5H10: TRAF1-TANk complex

TRAF1-TANk complex. Determined by X-ray diffraction at 3.21 Å resolution. Released 11 Oct 2017.

Method: X-ray diffraction
Resolution: 3.21 Å
Organisms: Homo sapiens, Peptide display vector fth1
Chains: 6
Atoms: 4,808
Mol. weight: 73.74 kDa
Released: 11 Oct 2017

Explore 5H10 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H10 contains 27 α-helices and 34 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	225-261	37
β-strand	268-274	7	1
α-helix	276-284	9
β-strand	291-292	2	2
α-helix	293-295	3
β-strand	296-297	2	2
β-strand	304-310	7	2
α-helix	315-317	3
β-strand	321-329	9	2
α-helix	334-336	3
β-strand	345-349	5	1
α-helix	350-351	2
β-strand	358-362	5	1
α-helix	369-371	3
β-strand	378	1	2
α-helix	379-381	3
β-strand	382-389	8	2
α-helix	390-394	5
β-strand	405-412	8	1
α-helix	413-414	2

Chain B: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	224-262	39
β-strand	268-274	7	3
α-helix	276-284	9
β-strand	291-292	2	4
α-helix	293-295	3
β-strand	296-297	2	4
β-strand	304-310	7	4
α-helix	315-317	3
β-strand	321-329	9	4
α-helix	334-336	3
β-strand	345-349	5	3
β-strand	358-362	5	3
α-helix	369-371	3
α-helix	373-374	2
β-strand	378	1	4
β-strand	382-389	8	4
α-helix	390-394	5
β-strand	405-412	8	3

Chain C: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	222-262	41
β-strand	268-274	7	5
α-helix	276-285	10
β-strand	291-292	2	6
α-helix	293-295	3
β-strand	296-297	2	6
β-strand	304-310	7	6
α-helix	315-317	3
β-strand	321-329	9	6
α-helix	334-336	3
β-strand	345-350	6	5
α-helix	351	1
β-strand	358-362	5	5
α-helix	369-371	3
β-strand	378	1	6
α-helix	379-381	3
β-strand	382-389	8	6
α-helix	390-392	3
β-strand	402	1	5
β-strand	405-412	8	5

Chains D, E and F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	4-5	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor-associated factor 1	A, B, C	protein	205	Homo sapiens	Q13077 (AlphaFold model)
TRAF family member-associated NF-kappaB activator	D, E, F	protein	8	Peptide display vector fth1	Q92844 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5H10_1 TNF receptor-associated factor 1 (chains A, B, C)
HQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRR
CHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPW
PFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHA
YVKDDTMFLKCIVETSTLEHHHHHH

Sequence of entity 2 (D, E, F), FASTA

>5H10_2 TRAF family member-associated NF-kappaB activator (chains D, E, F)
SVPIQCTD

Primary citation

TRAF1-TANk complex. Kim, C.M., Park, H.H. To be published.

Other PDB entries of the same protein (UniProt Q13077 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3M0D 2.8 Å, Crystal structure of the TRAF1:TRAF2:cIAP2 complex
5E1T 2.8 Å, Crystal structure of TRAF1 TRAF domain

Browse structure collections

About this viewer

MolViewer shows 5H10 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.