EED in complex with PRC2 allosteric inhibitor EED162. Determined by X-ray diffraction at 1.9 Å resolution. Released 25 Jan 2017.
Explore 5H19 in 3D Show helices and sheets RCSB PDB PDBe
5H19 contains 5 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 82-89 | 8 | 1 |
| β-strand | 98-101 | 4 | 2 |
| α-helix | 105-106 | 2 | |
| α-helix | 110 | 1 | |
| β-strand | 111-117 | 7 | 2 |
| β-strand | 120-126 | 7 | 2 |
| β-strand | 132-139 | 8 | 2 |
| β-strand | 147-154 | 8 | 3 |
| β-strand | 161-167 | 7 | 3 |
| β-strand | 171-176 | 6 | 3 |
| β-strand | 181-187 | 7 | 3 |
| β-strand | 193-198 | 6 | 4 |
| β-strand | 205-210 | 6 | 4 |
| β-strand | 215-219 | 5 | 4 |
| β-strand | 224-229 | 6 | 4 |
| β-strand | 239-244 | 6 | 5 |
| β-strand | 250-255 | 6 | 5 |
| β-strand | 260-264 | 5 | 5 |
| α-helix | 268-279 | 12 | |
| β-strand | 292-294 | 3 | 4 |
| β-strand | 299-301 | 3 | 5 |
| β-strand | 311-315 | 5 | 6 |
| β-strand | 318-322 | 5 | 6 |
| β-strand | 327-333 | 7 | 6 |
| β-strand | 350-357 | 8 | 6 |
| β-strand | 368-370 | 3 | 7 |
| β-strand | 376-380 | 5 | 7 |
| β-strand | 386-390 | 5 | 7 |
| β-strand | 401-404 | 4 | 7 |
| β-strand | 413-418 | 6 | 1 |
| β-strand | 424-429 | 6 | 1 |
| β-strand | 433-439 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 41-61 | 21 | |
| α-helix | 65-67 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polycomb protein EED | A | protein | 367 | Homo sapiens | O75530 (AlphaFold model) |
| Histone-lysine N-methyltransferase EZH2 | B | protein | 29 | Homo sapiens | Q15910 (AlphaFold model) |
>5H19_1 Polycomb protein EED (chains A) GKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRL LQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAIN ELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSC GMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRW LGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQ KMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASI WRWDRLR
>5H19_2 Histone-lysine N-methyltransferase EZH2 (chains B) SMFSSNRQKILERTEILNQEWKQRRIQPV
| ID | Name | Formula | Copies |
|---|---|---|---|
| LQF | 5-(furan-2-ylmethylamino)-9-(phenylmethyl)-8,10-dihydro-7H-[1,2,4]triazolo[3,4-… | C22 H20 N6 O | 1 |
Discovery and Molecular Basis of a Diverse Set of Polycomb Repressive Complex 2 Inhibitors Recognition by EED. Li, L., Zhang, H., Zhang, M. et al. PLoS One (2017) 12:e0169855-e0169855. DOI 10.1371/journal.pone.0169855 · PubMed
Other PDB entries of the same protein (UniProt O75530 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5H19 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.