HIV-1 CA N-terminal domain, open conformation. Determined by X-ray diffraction at 1.76 Å resolution. Released 10 Aug 2016.
Explore 5HGK in 3D Show helices and sheets RCSB PDB PDBe
5HGK contains 22 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-4 | 3 | 1 |
| β-strand | 10-12 | 3 | 1 |
| α-helix | 14-16 | 3 | |
| α-helix | 17-30 | 14 | |
| α-helix | 36-43 | 8 | |
| α-helix | 49-57 | 9 | |
| α-helix | 63-83 | 21 | |
| α-helix | 85-88 | 4 | |
| α-helix | 90-92 | 3 | |
| α-helix | 97-99 | 3 | |
| α-helix | 101-104 | 4 | |
| α-helix | 111-118 | 8 | |
| α-helix | 126-145 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Capsid protein | A, B | protein | 146 | Human immunodeficiency virus 1 | A9PKC6 |
>5HGK_1 Capsid protein (chains A, B) PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVG GHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTH NPPIPVGEIYKRWIILGLNKIVRMYS
HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis. Jacques, D.A., McEwan, W.A., Hilditch, L. et al. Nature (2016) 536:349-353. DOI 10.1038/nature19098 · PubMed
Other PDB entries of the same protein (UniProt A9PKC6), best resolution first:
MolViewer shows 5HGK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.