5HQI: Insulin A-Chain

Insulin with proline analog HzP at position B28 in the T2 state. Determined by X-ray diffraction at 0.97 Å resolution. Released 25 Jan 2017.

Method: X-ray diffraction
Resolution: 0.97 Å
Organism: Homo sapiens
Chains: 2
Atoms: 476
Mol. weight: 5.83 kDa
Released: 25 Jan 2017

Explore 5HQI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HQI contains 4 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	2-6	5
α-helix	13-17	5
β-strand	20	1	1

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	20-22	3
β-strand	24	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin A-Chain	A	protein	21	Homo sapiens	P01308 (AlphaFold model)
Insulin B-Chain	B	protein	30	Homo sapiens	P01308 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5HQI_1 Insulin A-Chain (chains A)
GIVEQCCTSICSLYQLENYCN

Sequence of entity 2 (B), FASTA

>5HQI_2 Insulin B-Chain (chains B)
FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Primary citation

4S-Hydroxylation of Insulin at ProB28 Accelerates Hexamer Dissociation and Delays Fibrillation. Lieblich, S.A., Fang, K.Y., Cahn, J.K.B. et al. J Am Chem Soc (2017) 139:8384-8387. DOI 10.1021/jacs.7b00794 · PubMed

Other PDB entries of the same protein (UniProt P01308 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3W7Y 0.92 Å, 0.92A structure of 2Zn human insulin at 100K
5E7W 0.95 Å, X-ray Structure of Human Recombinant 2Zn insulin at 0.92 Angstrom
1MSO 1.0 Å, T6 Human Insulin at 1.0 A Resolution
3HYD 1.0 Å, LVEALYL peptide derived from human insulin chain B, residues 11-17
6VER 1.05 Å, Human insulin analog: [GluB10,TyrB20]-DOI
4FKA 1.08 Å, High resolution structure of the manganese derivative of insulin
3TT8 1.12 Å, Crystal Structure Analysis of Cu Human Insulin Derivative
3W7Z 1.15 Å, 1.15A structure of human 2Zn insulin at 293K
8OKY 1.17 Å, Crystal structure of D-ProB26-DTriA analogue of human insulin
5USP 1.17 Å, Insulin with proline analog Pip at position B28 in the T2 state
5UOZ 1.17 Å, Insulin with proline analog FyP at position B28 in the T2 state
5URT 1.18 Å, Insulin with proline analog DhP at position B28 in the T2 state

Browse structure collections

About this viewer

MolViewer shows 5HQI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.