5HT6: SET domain of the human MLL5 methyltransferase

Name: PDB 5HT6: Crystal structure of the SET domain of the human MLL5 methyltransferase
Published: 2016-11-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Crystal structure of the SET domain of the human MLL5 methyltransferase. Determined by X-ray diffraction at 2.09 Å resolution. Released 16 Nov 2016.

Method: X-ray diffraction
Resolution: 2.09 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,011
Mol. weight: 32.21 kDa
Released: 16 Nov 2016

Explore 5HT6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HT6 contains 9 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	25-26	2	1
β-strand	41-42	2	1
β-strand	46	1	2
α-helix	47	1
β-strand	51-54	4	3
β-strand	58-61	4	4
α-helix	62-67	6
α-helix	70-71	2
β-strand	79-82	4	4
β-strand	90-93	4	4
α-helix	100-103	4
α-helix	104	1
β-strand	105-106	2	5
β-strand	112-119	8	3
β-strand	122-129	8	3
β-strand	133	1	2
β-strand	138	1	1
β-strand	140-141	2	5

Chain B: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	41	1	6
β-strand	46	1	7
β-strand	51-54	4	8
β-strand	58-61	4	9
α-helix	62-67	6
β-strand	79-82	4	9
β-strand	90-93	4	9
α-helix	100-103	4
β-strand	105-106	2	10
β-strand	112-119	8	8
β-strand	122-129	8	8
β-strand	133	1	7
α-helix	137	1
β-strand	138	1	6
α-helix	139	1
β-strand	140-141	2	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-lysine N-methyltransferase 2E	A, B	protein	138	Homo sapiens	Q8IZD2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5HT6_1 Histone-lysine N-methyltransferase 2E (chains A, B)
GPTNNLLFKPPVESHIQKNKKILKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYP
FVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHEIQDGTIHLYIYSIHSIPKGT
EITIAFDFDYGNAKYKVD

Primary citation

The Human Mixed Lineage Leukemia 5 (MLL5), a Sequentially and Structurally Divergent SET Domain-Containing Protein with No Intrinsic Catalytic Activity. Mas-Y-Mas, S., Barbon, M., Teyssier, C. et al. PLoS One (2016) 11:e0165139-e0165139. DOI 10.1371/journal.pone.0165139 · PubMed

Other PDB entries of the same protein (UniProt Q8IZD2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4L58 1.48 Å, Crystal structure of the MLL5 PHD finger in complex with H3K4me3
2LV9 Solution NMR structure of the PHD domain of human MLL5, Northeast structural genomics…

Browse structure collections

About this viewer

MolViewer shows 5HT6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.