5HU1: BACE1

BACE1 in complex with (R)-N-(3-(3-amino-2,5-dimethyl-1,1-dioxido-5,6-dihydro-2H-1,2,4-thiadiazin-5-yl)-4-fluorophenyl)-5-fluoropicolinamide. Determined by X-ray diffraction at 1.5 Å resolution. Released 9 Nov 2016.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,001
Mol. weight: 92.78 kDa
Ligands: 66F
Released: 9 Nov 2016

Explore 5HU1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HU1 contains 26 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	67-70	4	1
β-strand	74-81	8	1
β-strand	86-93	8	1
β-strand	99-102	4	1
α-helix	115-117	3
β-strand	122-132	11	1
β-strand	135-147	13	1
β-strand	155-167	13	1
β-strand	178-181	4	1
α-helix	185-187	3
α-helix	197-204	8
β-strand	211-215	5	1
α-helix	224-229	6
β-strand	233-237	5	1
α-helix	242-244	3
β-strand	245-253	9	1
β-strand	257	1	2
β-strand	260	1	2
β-strand	261-262	2	3
β-strand	264-269	6	4
β-strand	272-273	2	4
α-helix	278-282	5
β-strand	286-288	3	3
β-strand	295-298	4	3
α-helix	299-312	14
α-helix	320-323	4
β-strand	329-331	3	5
α-helix	338-340	3
α-helix	342-343	2
β-strand	344-349	6	4
β-strand	355-361	7	4
α-helix	363-366	4
β-strand	367-370	4	5
β-strand	379-383	5	5
β-strand	385-388	4	3
β-strand	392-394	3	3
α-helix	396-399	4
β-strand	402-407	6	1
β-strand	412-418	7	1
β-strand	430-436	7	4
α-helix	440-443	4

Chain B: 13 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	67-70	4	6
β-strand	74-81	8	6
β-strand	86-93	8	6
β-strand	99-102	4	6
α-helix	115-117	3
β-strand	122-131	10	6
β-strand	136-147	12	6
β-strand	155-167	13	6
β-strand	178-181	4	6
α-helix	185-187	3
α-helix	197-204	8
β-strand	211-215	5	6
α-helix	224-229	6
β-strand	233-237	5	6
α-helix	242-244	3
β-strand	245-253	9	6
β-strand	257	1	7
β-strand	260	1	7
β-strand	261-262	2	8
β-strand	264-269	6	9
β-strand	272-273	2	9
α-helix	278-282	5
β-strand	286-288	3	8
β-strand	295-298	4	8
α-helix	299-312	14
α-helix	320-323	4
β-strand	329-331	3	10
α-helix	338-340	3
α-helix	342-343	2
β-strand	344-349	6	9
β-strand	355-361	7	9
α-helix	363-366	4
β-strand	367-370	4	10
β-strand	379-383	5	10
β-strand	385-388	4	8
β-strand	392-394	3	8
α-helix	396-399	4
β-strand	402-407	6	6
β-strand	412-418	7	6
β-strand	430-436	7	9
α-helix	440-443	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-secretase 1	A, B	protein	412	Homo sapiens	P56817 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5HU1_1 Beta-secretase 1 (chains A, B)
LPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG
AAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAA
ITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPL
NQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYN
YDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFP
VISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGF
YVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDEST

Ligands and cofactors

ID	Name	Formula	Copies
66F	N-{3-[(5R)-3-amino-2,5-dimethyl-1,1-dioxido-5,6-dihydro-2H-1,2,4-thiadiazin-5-y…	C17 H17 F2 N5 O3 S	2

Primary citation

Discovery of the 3-Imino-1,2,4-thiadiazinane 1,1-Dioxide Derivative Verubecestat (MK-8931)-A beta-Site Amyloid Precursor Protein Cleaving Enzyme 1 Inhibitor for the Treatment of Alzheimer's Disease. Scott, J.D., Li, S.W., Brunskill, A.P. et al. J Med Chem (2016) 59:10435-10450. DOI 10.1021/acs.jmedchem.6b00307 · PubMed

Other PDB entries of the same protein (UniProt P56817 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7MYI 1.25 Å, BACE-1 in complex with compound #6
6UWP 1.29 Å, BACE-1 in complex with compound #32
6EQM 1.35 Å, Crystal Structure of Human BACE-1 in Complex with CNP520
4L7G 1.38 Å, Diethylaminosulfur Trifluoride-Mediated Intramolecular Cyclization of…
6EJ2 1.46 Å, BACE1 compound 28
6UWV 1.47 Å, BACE-1 in complex with compound #34
3VF3 1.48 Å, Crystal Structure of Human Beta Secretase in Complex with NVP-BQQ711
5HDZ 1.49 Å, BACE-1 in complex with (7aR)-7a-(5-cyanothiophen-2-yl)-6-(5-fluoro-4-methyl-6-(methylthio…
2QP8 1.5 Å, Structure of BACE Bound to SCH734723
4B78 1.5 Å, Aminoimidazoles as BACE-1 Inhibitors: From De Novo Design to Ab- lowering in Brain
4DJX 1.5 Å, Structure of BACE Bound to 5-(3-(5-chloropyridin-3-yl)phenyl)-5-cyclopropyl-2-imino-3-met…
6BFE 1.51 Å, BACE crystal structure with hydroxy pyrrolidine inhibitor

Browse structure collections

About this viewer

MolViewer shows 5HU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.