5HZ7: ComP

High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria meningitidis in fusion with MBP. Determined by X-ray diffraction at 1.43 Å resolution. Released 18 May 2016.

Method: X-ray diffraction
Resolution: 1.43 Å
Organism: Neisseria meningitidis
Chains: 1
Atoms: 4,578
Mol. weight: 54.67 kDa
Ligands: BGC
Released: 18 May 2016

Explore 5HZ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HZ7 contains 28 α-helices and 36 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	7	1	1
β-strand	10-11	2	2
α-helix	18-32	15
β-strand	35	1	1
β-strand	39	1	2
α-helix	44-52	9
β-strand	60-64	5	2
α-helix	65-67	3
α-helix	68-73	6
β-strand	77	1	3
α-helix	78-79	2
β-strand	80	1	4
α-helix	84-87	4
β-strand	90	1	5
α-helix	92-97	6
β-strand	99-100	2	4
β-strand	103-104	2	4
β-strand	107-112	6	2
β-strand	115-119	5	6
β-strand	129	1	7
α-helix	130-132	3
α-helix	133-141	9
β-strand	146-148	3	6
α-helix	155-164	10
β-strand	168-173	6	8
β-strand	176-183	8	8
α-helix	187-201	15
α-helix	211-219	9
β-strand	223-228	6	6
α-helix	230-232	3
α-helix	233-238	6
β-strand	243-246	4	6
α-helix	247-249	3
β-strand	250	1	7
β-strand	251	1	9
β-strand	254	1	9
α-helix	258	1
β-strand	259-260	2	10
β-strand	261-267	7	2
β-strand	268	1	3
α-helix	274-280	7
α-helix	281-285	5
α-helix	288-297	10
β-strand	302-303	2	2
β-strand	305	1	5
α-helix	306-312	7
α-helix	316-327	12
β-strand	329-330	2	10
α-helix	331-332	2
α-helix	337-353	17
α-helix	358-370	13
α-helix	372-373	2
α-helix	374-401	28
β-strand	407	1	11
β-strand	410	1	11
α-helix	411-414	4
β-strand	418-419	2	12
β-strand	422-427	6	12
β-strand	439-444	6	12
β-strand	453-457	5	12
β-strand	462-467	6	12
β-strand	478-479	2	12
β-strand	484-488	5	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ComP	A	protein	490	Neisseria meningitidis	P0AEX9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5HZ7_1 ComP (chains A)
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI
IFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK
DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIK
DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSA
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDA
ALAAAQTNAAAASEFEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAE
GFCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFK
GNDKDCKLFK

Ligands and cofactors

ID	Name	Formula	Copies
BGC	beta-D-glucopyranose	C6 H12 O6	1

Water and common crystallization additives (NA, EDO) are not listed.

Primary citation

A Comparative Structure/Function Analysis of Two Type IV Pilin DNA Receptors Defines a Novel Mode of DNA Binding. Berry, J.L., Xu, Y., Ward, P.N. et al. Structure (2016) 24:926-934. DOI 10.1016/j.str.2016.04.001 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan
3O3U 1.5 Å, Crystal Structure of Human Receptor for Advanced Glycation Endproducts (RAGE)

Browse structure collections

About this viewer

MolViewer shows 5HZ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.