5I1Q: Second bromodomain of TAF1

Second bromodomain of TAF1 bound to a pyrrolopyridone compound. Determined by X-ray diffraction at 1.5 Å resolution. Released 8 Jun 2016.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,333
Mol. weight: 16.91 kDa
Ligands: 67C
Released: 8 Jun 2016

Explore 5I1Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5I1Q contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	1503-1513	11
α-helix	1514-1519	6
α-helix	1526-1528	3
α-helix	1531-1533	3
α-helix	1540-1543	4
α-helix	1550-1558	9
α-helix	1565-1583	19
α-helix	1588-1606	19
α-helix	1608-1634	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 1	A	protein	144	Homo sapiens	P21675 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5I1Q_1 Transcription initiation factor TFIID subunit 1 (chains A)
GSPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIR
KNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQL
EKDICTAKEAALEEAELESLDPMT

Ligands and cofactors

ID	Name	Formula	Copies
67C	3-[6-(but-3-en-1-yl)-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]pyridin-4-yl]-N,N-dimet…	C20 H21 N3 O2	1

Primary citation

Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains. Crawford, T.D., Tsui, V., Flynn, E.M. et al. J Med Chem (2016) 59:5391-5402. DOI 10.1021/acs.jmedchem.6b00264 · PubMed

Other PDB entries of the same protein (UniProt P21675 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5I29 1.21 Å, TAF1(2) bound to a pyrrolopyridone compound
7LB1 1.35 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-585
4YYM 1.5 Å, Crystal structure of TAF1 BD2 Bromodomain bound to a butyryllysine peptide
7K27 1.5 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ATR…
7JJG 1.6 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K03 1.6 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ATR…
7T36 1.65 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ZS1-322
7JSP 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K3O 1.7 Å, Crystal structure of the unliganded second bromodomain (BD2) of human TAF1
7K42 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to dioxane
7LB2 1.7 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-589
5MG2 1.75 Å, Crystal structure of the second bromodomain of human TAF1 in complex with BAY-299…

Browse structure collections

About this viewer

MolViewer shows 5I1Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.