Second bromodomain of TAF1 bound to a pyrrolopyridone compound. Determined by X-ray diffraction at 1.5 Å resolution. Released 8 Jun 2016.
Explore 5I1Q in 3D Show helices and sheets RCSB PDB PDBe
5I1Q contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1503-1513 | 11 | |
| α-helix | 1514-1519 | 6 | |
| α-helix | 1526-1528 | 3 | |
| α-helix | 1531-1533 | 3 | |
| α-helix | 1540-1543 | 4 | |
| α-helix | 1550-1558 | 9 | |
| α-helix | 1565-1583 | 19 | |
| α-helix | 1588-1606 | 19 | |
| α-helix | 1608-1634 | 27 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcription initiation factor TFIID subunit 1 | A | protein | 144 | Homo sapiens | P21675 (AlphaFold model) |
>5I1Q_1 Transcription initiation factor TFIID subunit 1 (chains A) GSPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIR KNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQL EKDICTAKEAALEEAELESLDPMT
| ID | Name | Formula | Copies |
|---|---|---|---|
| 67C | 3-[6-(but-3-en-1-yl)-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]pyridin-4-yl]-N,N-dimet… | C20 H21 N3 O2 | 1 |
Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains. Crawford, T.D., Tsui, V., Flynn, E.M. et al. J Med Chem (2016) 59:5391-5402. DOI 10.1021/acs.jmedchem.6b00264 · PubMed
Other PDB entries of the same protein (UniProt P21675 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5I1Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.