5I2X: TPP1 K170del

Crystal Structure of TPP1 K170del. Determined by X-ray diffraction at 3.0 Å resolution. Released 9 Nov 2016.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,233
Mol. weight: 34.86 kDa
Released: 9 Nov 2016

Explore 5I2X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5I2X contains 13 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	93-95	3	1
α-helix	96-97	2
α-helix	99-104	6
β-strand	113-122	10	2
β-strand	142-147	6	2
β-strand	152-157	6	2
α-helix	159-164	6
β-strand	179-191	13	2
β-strand	194	1	3
β-strand	197	1	3
α-helix	198-199	2
β-strand	200-214	15	2
α-helix	216-219	4
β-strand	222	1	2
α-helix	223-225	3
α-helix	227-237	11

Chain B: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	93-95	3	1
α-helix	96-97	2
α-helix	99-104	6
β-strand	113-122	10	4
β-strand	142-147	6	4
β-strand	152-157	6	4
α-helix	159-163	5
β-strand	179-183	5	4
β-strand	186-191	6	4
α-helix	192-193	2
β-strand	200-205	6	4
β-strand	208-214	7	4
β-strand	222	1	4
α-helix	223-225	3
α-helix	227-236	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adrenocortical dysplasia protein homolog	A, B	protein	160	Homo sapiens	Q96AP0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5I2X_1 Adrenocortical dysplasia protein homolog (chains A, B)
SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDG
THSVRCLVTREALDTSDWEEEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFS
LLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNA

Primary citation

Structural and functional consequences of a disease mutation in the telomere protein TPP1. Bisht, K., Smith, E.M., Tesmer, V.M. et al. Proc Natl Acad Sci U S A (2016) 113:13021-13026. DOI 10.1073/pnas.1605685113 · PubMed

Other PDB entries of the same protein (UniProt Q96AP0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5H65 2.1 Å, Crystal structure of human POT1 and TPP1
5UN7 2.1 Å, Structure of the human POT1-TPP1 telomeric complex
5XYF 2.2 Å, Crystal structure of the human TIN2-TPP1-TRF2 telomeric complex
2I46 2.7 Å, Crystal structure of human TPP1
9Q16 2.7 Å, Human telomerase catalytic core with shelterin protein TPP1, dGpNHpp and DNA primer…
9Q12 2.8 Å, Human telomerase catalytic core with shelterin protein TPP1 and DNA primer ending in TTAG
7S1T 2.9 Å, Structure of the human POT1-TPP1 complex
9Q10 2.9 Å, Human telomerase catalytic core with shelterin protein TPP1, dTpNHpp and DNA primer…
9Q11 2.9 Å, Human telomerase catalytic core with shelterin protein TPP1, BIBR1532, dTpNHpp and DNA…
5I2Y 3.0 Å, Crystal Structure of TPP1 K170A
9Q14 3.0 Å, Human telomerase catalytic core with shelterin protein TPP1, BIBR1532 and DNA primer…
9Q0Z 3.1 Å, Human telomerase catalytic core with shelterin protein TPP1, BIBR1532 and DNA primer…

Browse structure collections

About this viewer

MolViewer shows 5I2X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.