5I4N: E596A V617F Mutant JAK2 Pseudokinase Domain

Crystal Structure of the E596A V617F Mutant JAK2 Pseudokinase Domain Bound to Mg-ATP. Determined by X-ray diffraction at 1.54 Å resolution. Released 13 Apr 2016.

Method: X-ray diffraction
Resolution: 1.54 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,436
Mol. weight: 33.87 kDa
Ligands: MG, ATP
Released: 13 Apr 2016

Explore 5I4N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5I4N contains 22 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	539	1	1
α-helix	542-544	3
β-strand	545-554	10	1
β-strand	557-567	11	1
α-helix	569-571	3
β-strand	573-584	12	1
α-helix	588-602	15
β-strand	609	1	2
α-helix	610-611	2
β-strand	612-616	5	1
β-strand	621-627	7	1
α-helix	628-629	2
β-strand	633	1	2
α-helix	634-640	7
α-helix	647-666	20
α-helix	676-678	3
β-strand	679-683	5	2
β-strand	686	1	3
β-strand	691	1	3
α-helix	692-693	2
β-strand	694-697	4	2
α-helix	698-699	2
α-helix	709-714	6
α-helix	721-725	5
α-helix	727-729	3
α-helix	732-746	15
α-helix	751-752	2
α-helix	759-767	9
α-helix	772-775	4
α-helix	778-780	3
α-helix	781-787	7
α-helix	792-794	3
α-helix	796-797	2
α-helix	798-808	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase JAK2	A	protein	290	Homo sapiens	O60674 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5I4N_1 Tyrosine-protein kinase JAK2 (chains A)
MVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESF
FAAASMMSKLSHKHLVLNYGVCFCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVA
KQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQE
RIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPA
PKAAELANLINNCMDYEPDHRPSFRAIIRDLNSLFTPDLVPRGSHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Uncoupling JAK2 V617F activation from cytokine-induced signalling by modulation of JH2 alpha C helix. Leroy, E., Dusa, A., Colau, D. et al. Biochem J (2016) 473:1579-1591. DOI 10.1042/BCJ20160085 · PubMed

Other PDB entries of the same protein (UniProt O60674 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8BXH 1.3 Å, Crystal structure of JAK2 JH1 in complex with momelotinib
7LL4 1.31 Å, High-resolution crystal structure of human JAK2 kinase domain (JH1) bound to PN5-114.
3UGC 1.34 Å, Structural basis of Jak2 inhibition by the type II inhibtor NVP-BBT594
7REE 1.38 Å, High-resolution crystal structure of human JAK2 kinase domain (JH1) bound to YM2-059
8BA3 1.4 Å, Crystal structure of JAK2 JH2 in complex with Bemcentinib
8BX9 1.4 Å, Crystal structure of JAK2 JH1 in complex with ilginatinib
7TEU 1.45 Å, Crystal structure of JAK2 JH1 with type II inhibitor YLIU-04-105-1
9TM5 1.45 Å, Crystal structure of JAK2 JH1 in complex with AT9283
4IVA 1.5 Å, JAK2 kinase (JH1 domain) in complex with the inhibitor TRANS-4-[(8AS)-2-[(1R)-1-HYDROXYET…
7LL5 1.5 Å, High-resolution crystal structure of human JAK2 kinase domain (JH1) bound to PN5-150.
7RN6 1.5 Å, High-resolution crystal structure of human JAK2 kinase domain (JH1) bound to type-II…
8B8U 1.5 Å, Crystal structure of JAK2 JH2-V617F in complex with HTS-A3

Browse structure collections

About this viewer

MolViewer shows 5I4N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.