5I4Z: Apo OmoMYC

Structure of apo OmoMYC. Determined by X-ray diffraction at 1.95 Å resolution. Released 26 Oct 2016.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,390
Mol. weight: 28.53 kDa
Released: 26 Oct 2016

Explore 5I4Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5I4Z contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	20-31	12
α-helix	45-90	46

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	20-31	12
α-helix	45-88	44

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myc proto-oncogene protein	A, B	protein	118	Homo sapiens	P01106 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5I4Z_1 Myc proto-oncogene protein (chains A, B)
MKHHHHHHPMSDYDIPTTENLYFQGAMATEENVKRRTHNVLERQRRNELKRSFFALRDQI
PELENNEKAPKVVILKKATAYILSVQAETQKLISEIDLLRKQNEQLKHKLEQLRNSCA

Primary citation

OmoMYC blunts promoter invasion by oncogenic MYC to inhibit gene expression characteristic of MYC-dependent tumors. Jung, L.A., Gebhardt, A., Koelmel, W. et al. Oncogene (2017) 36:1911-1924. DOI 10.1038/onc.2016.354 · PubMed

Other PDB entries of the same protein (UniProt P01106 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QNH 1.3 Å, Myc pS294 phosphopeptide binding to 14-3-3sigma
6G6K 1.35 Å, The crystal structures of Human MYC:MAX bHLHZip complex
1NKP 1.8 Å, Crystal structure of Myc-Max recognizing DNA
8Q1N 1.84 Å, Cyclic peptide binder of the WBM-site of WDR5
4Y7R 1.9 Å, Crystal structure of WDR5 in complex with MYC MbIIIb peptide
8J2Q 1.92 Å, Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment
8X8V 2.0 Å, Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment
8X8S 2.04 Å, Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment
1EE4 2.1 Å, Crystal structure of yeast karyopherin (importin) alpha in a complex with a C-myc nls…
6G6L 2.2 Å, The crystal structures of Human MYC:MAX bHLHZip complex
6G6J 2.25 Å, The crystal structures of Human MYC:MAX bHLHZip complex
6E16 2.4 Å, Ternary structure of c-Myc-TBP-TAF1

Browse structure collections

About this viewer

MolViewer shows 5I4Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.