6E16: Ternary structure of c-Myc-TBP-TAF1

Ternary structure of c-Myc-TBP-TAF1. Determined by X-ray diffraction at 2.4 Å resolution. Released 2 Oct 2019.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Saccharomyces cerevisiae, Homo sapiens, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 1
Atoms: 1,693
Mol. weight: 28.51 kDa
Released: 2 Oct 2019

Explore 6E16 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6E16 contains 8 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	15-24	10
α-helix	28-35	8
α-helix	198-203	6
α-helix	204-206	3
β-strand	266-275	10	1
α-helix	282-288	7
β-strand	292-293	2	1
β-strand	302-306	5	1
β-strand	311-315	5	1
β-strand	320-326	7	1
α-helix	329-346	18
β-strand	353-365	13	1
β-strand	370	1	2
α-helix	372-378	7
β-strand	383-384	2	1
β-strand	393-397	5	1
β-strand	402-406	5	1
β-strand	411-417	7	1
α-helix	420-436	17
β-strand	438	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 1,Myc proto-oncogene protein,TATA-box-binding protein	A	protein	267	Saccharomyces cerevisiae, Homo sapiens, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P01106 (AlphaFold model), P13393 (AlphaFold model), P46677 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6E16_1 Transcription initiation factor TFIID subunit 1,Myc proto-oncogene protein,TATA-box-binding protein (chains A)
KTNLANEDEAYEAIFGGEFGSLEIGSYIGGDEGGGSGGGSGGGSADQLEMVTELLGGDMV
NQSFICDPDDETFIGGGSGGGSGGGSMSGIVPTLQNIVATVTLGCRLDLKTVALHARNAE
YNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFT
DFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIV
LTGAKQREEIYQAFEAIYPVLSEFRKM

Primary citation

Multiple direct interactions of TBP with the MYC oncoprotein. Wei, Y., Resetca, D., Li, Z. et al. Nat Struct Mol Biol (2019) 26:1035-1043. DOI 10.1038/s41594-019-0321-z · PubMed

Other PDB entries of the same protein (UniProt P01106 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QNH 1.3 Å, Myc pS294 phosphopeptide binding to 14-3-3sigma
6G6K 1.35 Å, The crystal structures of Human MYC:MAX bHLHZip complex
1NKP 1.8 Å, Crystal structure of Myc-Max recognizing DNA
8Q1N 1.84 Å, Cyclic peptide binder of the WBM-site of WDR5
4Y7R 1.9 Å, Crystal structure of WDR5 in complex with MYC MbIIIb peptide
8J2Q 1.92 Å, Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment
5I4Z 1.95 Å, Structure of apo OmoMYC
8X8V 2.0 Å, Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment
8X8S 2.04 Å, Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment
1EE4 2.1 Å, Crystal structure of yeast karyopherin (importin) alpha in a complex with a C-myc nls…
6G6L 2.2 Å, The crystal structures of Human MYC:MAX bHLHZip complex
6G6J 2.25 Å, The crystal structures of Human MYC:MAX bHLHZip complex

Browse structure collections

About this viewer

MolViewer shows 6E16 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.