5I73: Ts3 human serotonin transporter

X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central and allosteric sites. Determined by X-ray diffraction at 3.24 Å resolution. Released 13 Apr 2016.

Method: X-ray diffraction
Resolution: 3.24 Å
Organisms: Homo sapiens, Mus musculus
Chains: 3
Atoms: 7,633
Mol. weight: 110.95 kDa
Ligands: 68P, NAG, CLR, C14
Released: 13 Apr 2016

Explore 5I73 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5I73 contains 58 α-helices and 47 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 45 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	85-96	12
α-helix	99	1
α-helix	100-104	5
α-helix	105-111	7
α-helix	114-117	4
α-helix	118-124	7
α-helix	125-129	5
α-helix	130-143	14
α-helix	149-152	4
α-helix	156-159	4
α-helix	160-172	13
α-helix	176-188	13
α-helix	196-198	3
β-strand	209	1	1
β-strand	225	1	1
α-helix	227-230	4
α-helix	231-236	6
α-helix	239-241	3
β-strand	251	1	2
α-helix	253-265	13
α-helix	267-270	4
α-helix	281-284	4
α-helix	287-301	15
α-helix	306-313	8
α-helix	317-321	5
α-helix	323-337	15
α-helix	343-349	7
α-helix	358-389	32
α-helix	394-397	4
α-helix	404	1
α-helix	405-410	6
α-helix	411-415	5
α-helix	420-453	34
β-strand	455	1	3
β-strand	458	1	3
α-helix	462-475	14
β-strand	482	1	2
α-helix	486-491	6
α-helix	492-496	5
α-helix	497-514	18
α-helix	518-528	11
α-helix	532-534	3
α-helix	535-539	5
α-helix	540-544	5
α-helix	545-558	14
α-helix	560-563	4
β-strand	564	1	4
β-strand	569	1	4
α-helix	570-571	2
α-helix	574-583	10
α-helix	588-599	12
α-helix	604-612	9
α-helix	614-615	2

Chain B: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	22-25	4	5
β-strand	29-31	3	6
β-strand	37-44	8	5
α-helix	48-50	3
β-strand	52-58	7	7
β-strand	64-71	8	7
β-strand	76-79	4	7
β-strand	87-92	6	5
β-strand	97-102	6	5
α-helix	107-109	3
β-strand	112-118	7	7
β-strand	127	1	7
β-strand	132-133	2	7
β-strand	134-136	3	6
α-helix	142-144	3
β-strand	145-148	4	8
α-helix	150-152	3
β-strand	160-170	11	8
β-strand	176-179	4	9
α-helix	180-182	3
β-strand	188-196	9	8
β-strand	199-209	11	8
β-strand	219-224	6	9
β-strand	229-234	6	9

Chain C: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	25	1	10
β-strand	30-34	5	11
β-strand	39-44	6	10
β-strand	53-58	6	11
β-strand	65-69	5	11
β-strand	73-74	2	11
α-helix	75	1
β-strand	82-86	5	10
β-strand	90-95	6	10
α-helix	100-102	3
β-strand	105-110	6	11
α-helix	116	1
β-strand	122-127	6	11
β-strand	131	1	12
β-strand	134-138	5	13
α-helix	139-141	3
α-helix	142-147	6
β-strand	149-159	11	13
β-strand	160	1	12
β-strand	165-169	5	14
β-strand	174-175	2	14
β-strand	179-183	5	13
α-helix	184-187	4
β-strand	193-202	10	13
α-helix	203-206	4
β-strand	211-217	7	14
α-helix	224	1
β-strand	225-230	6	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium-dependent serotonin transporter	A	protein	549	Homo sapiens	P31645 (AlphaFold model)
8B6 antibody, heavy chain	B	protein	221	Mus musculus
8B6 antibody, light chain	C	protein	214	Mus musculus

Sequence of entity 1 (A), FASTA

>5I73_1 Sodium-dependent serotonin transporter (chains A)
GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLF
YMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTD
QLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISW
QLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYL
KPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSF
VSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLIT
LGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLE
EYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFII
ASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSIT
PETPTLVPR

Sequence of entity 2 (B), FASTA

>5I73_2 8B6 antibody, heavy chain (chains B)
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSY
NQKFKGKATLTVDKSSTTAYMELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSA
KTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGL
YTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP

Sequence of entity 3 (C), FASTA

>5I73_3 8B6 antibody, light chain (chains C)
DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPD
RFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Ligands and cofactors

ID	Name	Formula	Copies
68P	(1S)-1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-…	C20 H21 F N2 O	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
CLR	Cholesterol	C27 H46 O	1
C14	Tetradecane	C14 H30	1
ACA	6-aminohexanoic acid	C6 H13 N O2	1

Water and common crystallization additives (NA) are not listed.

Primary citation

X-ray structures and mechanism of the human serotonin transporter. Coleman, J.A., Green, E.M., Gouaux, E. Nature (2016) 532:334-339. DOI 10.1038/nature17629 · PubMed

Other PDB entries of the same protein (UniProt P31645 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9HCO 2.78 Å, Outward-open structure of human serotonin transporter bound to vilazodone
7TXT 3.0 Å, Structure of human serotonin transporter bound to small molecule '8090 in lipid nanodisc…
5I6X 3.14 Å, X-ray structure of the ts3 human serotonin transporter complexed with paroxetine at the…
5I71 3.15 Å, X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at…
9VWS 3.2 Å, Cryo-EM structure of human serotonin transporter in complex with tesofensine
9IY7 3.27 Å, Cryo-EM structure of the wild-type human serotonin transporter complexed with S-ketamine
6VRH 3.3 Å, Cryo-EM structure of the wild-type human serotonin transporter complexed with paroxetine…
7LIA 3.3 Å, 5-HT bound serotonin transporter reconstituted in lipid nanodisc in presence of NaCl in…
5I74 3.4 Å, X-ray structure of the ts3 human serotonin transporter complexed with Br-citalopram at…
9PNS 3.4 Å, Structure of human serotonin transporter bound to small molecule zPZd in lipid nanodisc…
5I75 3.49 Å, X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at…
7LI6 3.5 Å, apo SERT reconstituted in lipid nanodisc in KCl

Browse structure collections

About this viewer

MolViewer shows 5I73 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.