X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central and allosteric sites. Determined by X-ray diffraction at 3.24 Å resolution. Released 13 Apr 2016.
Explore 5I73 in 3D Show helices and sheets RCSB PDB PDBe
5I73 contains 58 α-helices and 47 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 85-96 | 12 | |
| α-helix | 99 | 1 | |
| α-helix | 100-104 | 5 | |
| α-helix | 105-111 | 7 | |
| α-helix | 114-117 | 4 | |
| α-helix | 118-124 | 7 | |
| α-helix | 125-129 | 5 | |
| α-helix | 130-143 | 14 | |
| α-helix | 149-152 | 4 | |
| α-helix | 156-159 | 4 | |
| α-helix | 160-172 | 13 | |
| α-helix | 176-188 | 13 | |
| α-helix | 196-198 | 3 | |
| β-strand | 209 | 1 | 1 |
| β-strand | 225 | 1 | 1 |
| α-helix | 227-230 | 4 | |
| α-helix | 231-236 | 6 | |
| α-helix | 239-241 | 3 | |
| β-strand | 251 | 1 | 2 |
| α-helix | 253-265 | 13 | |
| α-helix | 267-270 | 4 | |
| α-helix | 281-284 | 4 | |
| α-helix | 287-301 | 15 | |
| α-helix | 306-313 | 8 | |
| α-helix | 317-321 | 5 | |
| α-helix | 323-337 | 15 | |
| α-helix | 343-349 | 7 | |
| α-helix | 358-389 | 32 | |
| α-helix | 394-397 | 4 | |
| α-helix | 404 | 1 | |
| α-helix | 405-410 | 6 | |
| α-helix | 411-415 | 5 | |
| α-helix | 420-453 | 34 | |
| β-strand | 455 | 1 | 3 |
| β-strand | 458 | 1 | 3 |
| α-helix | 462-475 | 14 | |
| β-strand | 482 | 1 | 2 |
| α-helix | 486-491 | 6 | |
| α-helix | 492-496 | 5 | |
| α-helix | 497-514 | 18 | |
| α-helix | 518-528 | 11 | |
| α-helix | 532-534 | 3 | |
| α-helix | 535-539 | 5 | |
| α-helix | 540-544 | 5 | |
| α-helix | 545-558 | 14 | |
| α-helix | 560-563 | 4 | |
| β-strand | 564 | 1 | 4 |
| β-strand | 569 | 1 | 4 |
| α-helix | 570-571 | 2 | |
| α-helix | 574-583 | 10 | |
| α-helix | 588-599 | 12 | |
| α-helix | 604-612 | 9 | |
| α-helix | 614-615 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22-25 | 4 | 5 |
| β-strand | 29-31 | 3 | 6 |
| β-strand | 37-44 | 8 | 5 |
| α-helix | 48-50 | 3 | |
| β-strand | 52-58 | 7 | 7 |
| β-strand | 64-71 | 8 | 7 |
| β-strand | 76-79 | 4 | 7 |
| β-strand | 87-92 | 6 | 5 |
| β-strand | 97-102 | 6 | 5 |
| α-helix | 107-109 | 3 | |
| β-strand | 112-118 | 7 | 7 |
| β-strand | 127 | 1 | 7 |
| β-strand | 132-133 | 2 | 7 |
| β-strand | 134-136 | 3 | 6 |
| α-helix | 142-144 | 3 | |
| β-strand | 145-148 | 4 | 8 |
| α-helix | 150-152 | 3 | |
| β-strand | 160-170 | 11 | 8 |
| β-strand | 176-179 | 4 | 9 |
| α-helix | 180-182 | 3 | |
| β-strand | 188-196 | 9 | 8 |
| β-strand | 199-209 | 11 | 8 |
| β-strand | 219-224 | 6 | 9 |
| β-strand | 229-234 | 6 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 25 | 1 | 10 |
| β-strand | 30-34 | 5 | 11 |
| β-strand | 39-44 | 6 | 10 |
| β-strand | 53-58 | 6 | 11 |
| β-strand | 65-69 | 5 | 11 |
| β-strand | 73-74 | 2 | 11 |
| α-helix | 75 | 1 | |
| β-strand | 82-86 | 5 | 10 |
| β-strand | 90-95 | 6 | 10 |
| α-helix | 100-102 | 3 | |
| β-strand | 105-110 | 6 | 11 |
| α-helix | 116 | 1 | |
| β-strand | 122-127 | 6 | 11 |
| β-strand | 131 | 1 | 12 |
| β-strand | 134-138 | 5 | 13 |
| α-helix | 139-141 | 3 | |
| α-helix | 142-147 | 6 | |
| β-strand | 149-159 | 11 | 13 |
| β-strand | 160 | 1 | 12 |
| β-strand | 165-169 | 5 | 14 |
| β-strand | 174-175 | 2 | 14 |
| β-strand | 179-183 | 5 | 13 |
| α-helix | 184-187 | 4 | |
| β-strand | 193-202 | 10 | 13 |
| α-helix | 203-206 | 4 | |
| β-strand | 211-217 | 7 | 14 |
| α-helix | 224 | 1 | |
| β-strand | 225-230 | 6 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sodium-dependent serotonin transporter | A | protein | 549 | Homo sapiens | P31645 (AlphaFold model) |
| 8B6 antibody, heavy chain | B | protein | 221 | Mus musculus | |
| 8B6 antibody, light chain | C | protein | 214 | Mus musculus |
>5I73_1 Sodium-dependent serotonin transporter (chains A) GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLF YMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTD QLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISW QLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYL KPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSF VSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLIT LGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLE EYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFII ASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSIT PETPTLVPR
>5I73_2 8B6 antibody, heavy chain (chains B) EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSY NQKFKGKATLTVDKSSTTAYMELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSA KTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGL YTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP
>5I73_3 8B6 antibody, light chain (chains C) DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPD RFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPP SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
| ID | Name | Formula | Copies |
|---|---|---|---|
| 68P | (1S)-1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-… | C20 H21 F N2 O | 2 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
| CLR | Cholesterol | C27 H46 O | 1 |
| C14 | Tetradecane | C14 H30 | 1 |
| ACA | 6-aminohexanoic acid | C6 H13 N O2 | 1 |
Water and common crystallization additives (NA) are not listed.
X-ray structures and mechanism of the human serotonin transporter. Coleman, J.A., Green, E.M., Gouaux, E. Nature (2016) 532:334-339. DOI 10.1038/nature17629 · PubMed
Other PDB entries of the same protein (UniProt P31645 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5I73 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.