5IEI: Cation-independent mannose-6-phosphate receptor

X-ray crystallographic structure of a high affinity IGF2 antagonist (Domain11 AB5 RHH) based on human IGF2R domain 11. Determined by X-ray diffraction at 2.8 Å resolution. Released 18 May 2016.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,042
Mol. weight: 15.96 kDa
Released: 18 May 2016

Explore 5IEI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IEI contains 3 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	1512-1513	2	1
β-strand	1517-1520	4	2
β-strand	1525-1528	4	2
α-helix	1530-1532	3
β-strand	1538-1540	3	3
β-strand	1541-1542	2	1
β-strand	1548-1550	3	3
β-strand	1563-1567	5	3
β-strand	1573-1576	4	3
β-strand	1581-1584	4	1
β-strand	1587-1592	6	1
β-strand	1597	1	4
α-helix	1598	1
β-strand	1605	1	4
β-strand	1607-1614	8	1
β-strand	1625-1630	6	1
β-strand	1635-1642	8	1
α-helix	1643-1645	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cation-independent mannose-6-phosphate receptor	A	protein	142	Homo sapiens	P11717 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5IEI_1 Cation-independent mannose-6-phosphate receptor (chains A)
MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACF
GRTRISVGKANKRLRYVDQVLQLVYKDGSHCPSKHGLSYKSVISFVCRPEAGPTNRPMLI
SLDKQTCTLFFSWHTPLACELA

Primary citation

Functional evolution of IGF2:IGF2R domain 11 binding generates novel structural interactions and a specific IGF2 antagonist. Frago, S., Nicholls, R.D., Strickland, M. et al. Proc Natl Acad Sci U S A (2016) 113:E2766-E2775. DOI 10.1073/pnas.1513023113 · PubMed

Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GP0 1.4 Å, Human IGF2R domain 11
6Z30 1.5 Å, Human cation-independent mannose 6-phosphate/ IGF2 receptor domains 9-10
1E6F 1.75 Å, Human MIR-receptor, repeat 11
1GQB 1.8 Å, Human mir-receptor, repeat 11
1GP3 1.95 Å, Human IGF2R domain 11
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
6N5X 2.05 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
6N5Y 2.26 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
1LF8 2.3 Å, Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
1JPL 2.4 Å, GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose…
6V02 2.46 Å, N-terminal 5 domains of CI-MPR
6P8I 2.54 Å, N-terminal 5 domains of IGFIIR

Browse structure collections

About this viewer

MolViewer shows 5IEI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.