X-ray crystallographic structure of a high affinity IGF2 antagonist (Domain11 AB5 RHH) based on human IGF2R domain 11. Determined by X-ray diffraction at 2.8 Å resolution. Released 18 May 2016.
Explore 5IEI in 3D Show helices and sheets RCSB PDB PDBe
5IEI contains 3 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1512-1513 | 2 | 1 |
| β-strand | 1517-1520 | 4 | 2 |
| β-strand | 1525-1528 | 4 | 2 |
| α-helix | 1530-1532 | 3 | |
| β-strand | 1538-1540 | 3 | 3 |
| β-strand | 1541-1542 | 2 | 1 |
| β-strand | 1548-1550 | 3 | 3 |
| β-strand | 1563-1567 | 5 | 3 |
| β-strand | 1573-1576 | 4 | 3 |
| β-strand | 1581-1584 | 4 | 1 |
| β-strand | 1587-1592 | 6 | 1 |
| β-strand | 1597 | 1 | 4 |
| α-helix | 1598 | 1 | |
| β-strand | 1605 | 1 | 4 |
| β-strand | 1607-1614 | 8 | 1 |
| β-strand | 1625-1630 | 6 | 1 |
| β-strand | 1635-1642 | 8 | 1 |
| α-helix | 1643-1645 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cation-independent mannose-6-phosphate receptor | A | protein | 142 | Homo sapiens | P11717 (AlphaFold model) |
>5IEI_1 Cation-independent mannose-6-phosphate receptor (chains A) MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACF GRTRISVGKANKRLRYVDQVLQLVYKDGSHCPSKHGLSYKSVISFVCRPEAGPTNRPMLI SLDKQTCTLFFSWHTPLACELA
Functional evolution of IGF2:IGF2R domain 11 binding generates novel structural interactions and a specific IGF2 antagonist. Frago, S., Nicholls, R.D., Strickland, M. et al. Proc Natl Acad Sci U S A (2016) 113:E2766-E2775. DOI 10.1073/pnas.1513023113 · PubMed
Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5IEI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.