5INB: PDB entry 5INB

RepoMan-PP1g (protein phosphatase 1, gamma isoform) holoenzyme complex. Determined by X-ray diffraction at 1.3 Å resolution. Released 5 Oct 2016.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,128
Mol. weight: 40.82 kDa
Ligands: MLI
Released: 5 Oct 2016

Explore 5INB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5INB contains 15 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9
α-helix	18-21	4
α-helix	23	1
α-helix	32-48	17
β-strand	52-55	4	1
β-strand	59-62	4	2
β-strand	64	1	3
α-helix	69-79	11
β-strand	87-89	3	2
α-helix	100-113	14
β-strand	118-120	3	2
α-helix	128-131	4
α-helix	136-143	8
α-helix	146-156	11
β-strand	162-165	4	1
β-strand	169-171	3	1
α-helix	183-187	5
α-helix	200-206	7
β-strand	208-209	2	4
β-strand	216-218	3	4
β-strand	225-227	3	4
α-helix	229-239	11
β-strand	243-246	4	1
β-strand	255-258	4	1
β-strand	263-266	4	1
β-strand	267	1	3
α-helix	272-274	3
β-strand	280-285	6	2
β-strand	290-298	9	2

Chain B: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	394-395	2	2
α-helix	400-401	2
β-strand	402-404	3	2
β-strand	415	1	2
α-helix	416-418	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein phosphatase PP1-gamma catalytic subunit	A	protein	305	Homo sapiens	P36873 (AlphaFold model)
Cell division cycle-associated protein 2	B	protein	46	Homo sapiens	Q69YH5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5INB_1 Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (chains A)
GHMLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICG
DIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRG
NHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSM
EQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDL
ICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK
PNATR

Sequence of entity 2 (B), FASTA

>5INB_2 Cell division cycle-associated protein 2 (chains B)
GAMGYAFLNMRKRKRVTFGEDLSPEVFDESLPANTPLRKGGTPVCK

Ligands and cofactors

ID	Name	Formula	Copies
MLI	Malonate ion	C3 H2 O4	1

Water and common crystallization additives (NA, GOL) are not listed.

Primary citation

The Ki-67 and RepoMan mitotic phosphatases assemble via an identical, yet novel mechanism. Kumar, G.S., Gokhan, E., De Munter, S. et al. Elife (2016) 5. DOI 10.7554/eLife.16539 · PubMed

Other PDB entries of the same protein (UniProt P36873 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1JK7 1.9 Å, Crystal structure of the tumor-promoter okadaic acid bound to protein phosphatase-1
4UT2 1.96 Å, X-ray structure of the human PP1 gamma catalytic subunit treated with ascorbate
1IT6 2.0 Å, Crystal structure of the complex between calyculin a and the catalytic subunit of…
1U32 2.0 Å, Crystal structure of a Protein Phosphatase-1: Calcineurin Hybrid Bound to Okadaic Acid
5J28 2.0 Å, Ki67-PP1g (protein phosphatase 1, gamma isoform) holoenzyme complex
2BCD 2.1 Å, X-ray crystal structure of Protein Phosphatase-1 with the marine toxin motuporin bound
4UT3 2.19 Å, X-ray structure of the human PP1 gamma catalytic subunit treated with hydrogen peroxide
2BDX 2.3 Å, X-ray Crystal Structure of dihydromicrocystin-LA bound to Protein Phosphatase-1
7SD0 2.95 Å, Cryo-EM structure of the SHOC2:PP1C:MRAS complex
8B5R 6.1 Å, p97-p37-SPI substrate complex

Browse structure collections

About this viewer

MolViewer shows 5INB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.