5IOI: N-terminal domain of human doublecortin

X-ray structure of the N-terminal domain of human doublecortin. Determined by X-ray diffraction at 2.4 Å resolution. Released 23 Mar 2016.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,085
Mol. weight: 73.82 kDa
Released: 23 Mar 2016

Explore 5IOI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IOI contains 13 α-helices and 38 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	128	1	1
β-strand	134-140	7	2
β-strand	149-153	5	2
β-strand	158	1	3
α-helix	161-172	12
β-strand	184-187	4	2
β-strand	193-194	2	2
α-helix	197-199	3
β-strand	205-209	5	2
α-helix	224-229	6

Chains B and D: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	134-140	7	3
β-strand	149-153	5	3
α-helix	161-172	12
β-strand	184-187	4	3
β-strand	193-194	2	3
α-helix	197-199	3
β-strand	205-209	5	3

Chains C and F: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	134-140	7	1
β-strand	149-153	5	1
α-helix	161-172	12
β-strand	174	1	4
β-strand	178	1	4
β-strand	184-187	4	1
β-strand	193-194	2	1
α-helix	197-199	3
β-strand	205-209	5	1

Chain E: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	128	1	6
β-strand	134-140	7	7
β-strand	149-153	5	7
β-strand	158	1	5
α-helix	161-172	12
β-strand	184-187	4	7
β-strand	193-194	2	7
β-strand	205-209	5	7
α-helix	224-229	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuronal migration protein doublecortin	A, B, C, D, E, F	protein	107	Homo sapiens	O43602 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>5IOI_1 Neuronal migration protein doublecortin (chains A, B, C, D, E, F)
LVPRGSHMAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRY
IYTIDGSRKIGSMDELEEGESYVCSSDNFFDDVEYTKNVNPNWSVNV

Primary citation

Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies. Burger, D., Stihle, M., Sharma, A. et al. J Biol Chem (2016) 291:16292-16306. DOI 10.1074/jbc.M116.726547 · PubMed

Other PDB entries of the same protein (UniProt O43602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IO9 1.3 Å, X-ray structure of the N-terminal domain of human doublecortin
5IP4 1.81 Å, X-ray structure of the C-terminal domain of human doublecortin
5IKC 2.06 Å, X-RAY STRUCTURE OF THE N-TERMINAL DOMAIN OF HUMAN DOUBLECORTIN in complex with FAB
2BQQ 2.2 Å, X-ray Structure of the N-terminal Domain of Human Doublecortin
6FNZ 2.23 Å, Crystal Structure of domain-swapped C-terminal domain of human doublecortin
5IN7 2.48 Å, X-ray structure of the N-terminal domain of human doublecortin
6REV 3.8 Å, Cryo-EM structure of the N-terminal DC repeat (NDC) of human doublecortin (DCX) bound to…
6RF8 3.8 Å, Cryo-EM structure of the N-terminal DC repeat (NDC) of NDC-NDC chimera (human sequence)…
6RFD 3.9 Å, Cryo-EM structure of the N-terminal DC repeat (NDC) of NDC-NDC chimera (human sequence)…
6RF2 4.2 Å, Cryo-EM structure of the C-terminal DC repeat (CDC) of human doublecortin (DCX) bound to…
2XRP 8.2 Å, Human Doublecortin N-DC Repeat (1MJD) and Mammalian Tubulin (1JFF and 3HKE) Docked into…
4ATU 8.3 Å, Human doublecortin N-DC repeat plus linker, and tubulin (2XRP) docked into an 8A cryo-EM…

Browse structure collections

About this viewer

MolViewer shows 5IOI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.