5J45: Shrub, fly ortholog of SNF7/CHMP4B

Crystal structure of Shrub, fly ortholog of SNF7/CHMP4B. Determined by X-ray diffraction at 2.76 Å resolution. Released 20 Jul 2016.

Method: X-ray diffraction
Resolution: 2.76 Å
Organism: Drosophila melanogaster
Chains: 1
Atoms: 890
Mol. weight: 14.75 kDa
Released: 20 Jul 2016

Explore 5J45 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5J45 contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	21-53	33
α-helix	58-126	69

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GH13992p	A	protein	127	Drosophila melanogaster	Q8T0Q4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5J45_1 GH13992p (chains A)
STGEAIQKLRETENMLIKKQEFLEAKIEDELNIARKNASKNKRVALQALKKKKRLEKQLQ
QIDGTLSTIEMQREALESANTNTAVLTTMKNAADALKRAHQNMDVDKVHDMMDDIAEQQD
VAREISD

Primary citation

Electrostatic Interactions between Elongated Monomers Drive Filamentation of Drosophila Shrub, a Metazoan ESCRT-III Protein. McMillan, B.J., Tibbe, C., Jeon, H. et al. Cell Rep (2016) 16:1211-1217. DOI 10.1016/j.celrep.2016.06.093 · PubMed

Other PDB entries of the same protein (UniProt Q8T0Q4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VO5 2.0 Å, Crystal structure of Lgd-Shrub complex, single chain fusion

Browse structure collections

About this viewer

MolViewer shows 5J45 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.