5VO5: Lgd-Shrub complex, single chain fusion

Crystal structure of Lgd-Shrub complex, single chain fusion. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Jun 2017.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Drosophila melanogaster
Chains: 1
Atoms: 1,476
Mol. weight: 20.91 kDa
Released: 14 Jun 2017

Explore 5VO5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5VO5 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	4-24	21
α-helix	28-49	22
α-helix	56-58	3
α-helix	77-112	36
α-helix	118-174	57
α-helix	179-188	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coiled-coil and C2 domain-containing protein 1-like,GH13992p	A	protein	190	Drosophila melanogaster	Q8T0Q4 (AlphaFold model), Q9VKJ9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5VO5_1 Coiled-coil and C2 domain-containing protein 1-like,GH13992p (chains A)
STNMLEALQQRLEKYQSVEAAAKAENNSGKARRFGRIVKQYEDAIKLYKAGKPVPYDELP
VPPGFGGGGGGGGGGGTTGEAIQKLRETENMLIKKQEFLEAKIEDELNIARKNASKNKEV
ALQALKKKKELEKQLQQIDGTLSTIEMQREALESANTNTAVLTTMKNAADALKRAHQNMD
VDKVHDMMDD

Primary citation

Structural Basis for Regulation of ESCRT-III Complexes by Lgd. McMillan, B.J., Tibbe, C., Drabek, A.A. et al. Cell Rep (2017) 19:1750-1757. DOI 10.1016/j.celrep.2017.05.026 · PubMed

Other PDB entries of the same protein (UniProt Q8T0Q4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5J45 2.76 Å, Crystal structure of Shrub, fly ortholog of SNF7/CHMP4B

Browse structure collections

About this viewer

MolViewer shows 5VO5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.