Crystal structure of factor IXa variant V16I K98T Y177T I213V in complex with EGR-chloromethylketone. Determined by X-ray diffraction at 1.56 Å resolution. Released 1 Jun 2016.
Explore 5JBB in 3D Show helices and sheets RCSB PDB PDBe
5JBB contains 12 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 91-94 | 4 | |
| β-strand | 98-101 | 4 | 1 |
| β-strand | 107-110 | 4 | 1 |
| β-strand | 115-117 | 3 | 2 |
| β-strand | 124-126 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 3 |
| β-strand | 20-21 | 2 | 4 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-34 | 5 | 5 |
| β-strand | 42-48 | 7 | 5 |
| β-strand | 51-54 | 4 | 5 |
| α-helix | 56-58 | 3 | |
| β-strand | 65-68 | 4 | 5 |
| β-strand | 72 | 1 | 6 |
| β-strand | 81-90 | 10 | 5 |
| β-strand | 104-108 | 5 | 5 |
| β-strand | 115 | 1 | 7 |
| β-strand | 118 | 1 | 7 |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 4 |
| α-helix | 126-132 | 9 | |
| β-strand | 135-140 | 6 | 4 |
| β-strand | 143 | 1 | 8 |
| α-helix | 150 | 1 | |
| β-strand | 151 | 1 | 8 |
| α-helix | 152 | 1 | |
| β-strand | 154 | 1 | 6 |
| α-helix | 155 | 1 | |
| β-strand | 156-162 | 7 | 4 |
| α-helix | 165-170 | 6 | |
| β-strand | 180-183 | 4 | 4 |
| β-strand | 189 | 1 | 3 |
| α-helix | 197 | 1 | |
| β-strand | 198-203 | 6 | 4 |
| β-strand | 206-215 | 10 | 4 |
| β-strand | 226-230 | 5 | 4 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-241 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coagulation factor IX | E | protein | 58 | Homo sapiens | P00740 (AlphaFold model) |
| Coagulation factor IX | S | protein | 235 | Homo sapiens | P00740 (AlphaFold model) |
>5JBB_1 Coagulation factor IX (chains E) CNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTR
>5JBB_2 Coagulation factor IX (chains S) IVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEE TEHTEQKRNVIRIIPHHNYNAAINTYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFL KFGSGYVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTITNNMFCAGFHEGGRDS CQGDSGGPHVTEVEGTSFLTGIVSWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
| ID | Name | Formula | Copies |
|---|---|---|---|
| 0GJ | L-alpha-glutamyl-N-{(1S)-4-{[amino(iminio)methyl]amino}-1-[(1S)-2-chloro-1-hydr… | C14 H28 Cl N6 O5 | 1 |
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (DMS) are not listed.
Releasing the brakes in coagulation Factor IXa by co-operative maturation of the substrate-binding site. Kristensen, L.H., Olsen, O.H., Blouse, G.E. et al. Biochem J (2016) 473:2395-2411. DOI 10.1042/BCJ20160336 · PubMed
Other PDB entries of the same protein (UniProt P00740 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5JBB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.