5JEJ: Phosphorylated STING

Phosphorylated STING in complex with IRF-3 CTD. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Jun 2016.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 5
Atoms: 4,338
Mol. weight: 66.54 kDa
Released: 15 Jun 2016

Explore 5JEJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JEJ contains 18 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	191-195	5
β-strand	202	1	3
β-strand	204-210	7	4
β-strand	213-220	8	4
β-strand	226-229	4	5
β-strand	241-244	4	5
α-helix	245-247	3
α-helix	255-265	11
β-strand	272-277	6	5
β-strand	280-285	6	5
β-strand	289	1	2
β-strand	291-296	6	4
β-strand	309-310	2	4
β-strand	317-321	5	5
α-helix	322-333	12
α-helix	338-341	4
β-strand	343-348	6	4
α-helix	358-360	3
β-strand	364-369	6	4
α-helix	370-382	13
β-strand	389-391	3	6
β-strand	395	1	3
β-strand	401-403	3	6
α-helix	405-416	12

Chain B: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	191-196	6
β-strand	202	1	7
β-strand	203-210	8	8
β-strand	213-221	9	8
β-strand	226-229	4	9
β-strand	241-244	4	9
α-helix	245-247	3
α-helix	255-265	11
β-strand	272-277	6	9
β-strand	280-285	6	9
β-strand	289	1	1
β-strand	291-296	6	8
β-strand	309-310	2	8
α-helix	311-312	2
β-strand	317-321	5	9
α-helix	322-333	12
α-helix	338-341	4
β-strand	343-348	6	8
α-helix	358-360	3
β-strand	364-369	6	8
α-helix	370-382	13
β-strand	389-391	3	10
β-strand	395	1	7
β-strand	401-403	3	10
α-helix	405-417	13

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	365	1	1
α-helix	372-374	3

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	365	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stimulator of interferon genes protein	C, D, E	protein	39	Homo sapiens	Q86WV6 (AlphaFold model)
Interferon regulatory factor 3	A, B	protein	242	Homo sapiens	Q14653 (AlphaFold model)

Sequence of entity 1 (C, D, E), FASTA

>5JEJ_1 Stimulator of interferon genes protein (chains C, D, E)
STVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDWS

Sequence of entity 2 (A, B), FASTA

>5JEJ_2 Interferon regulatory factor 3 (chains A, B)
SEFENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTL
PDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGH
GPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMV
KVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPG
ES

Primary citation

Structural basis for concerted recruitment and activation of IRF-3 by innate immune adaptor proteins. Zhao, B., Shu, C., Gao, X. et al. Proc Natl Acad Sci U S A (2016) 113:E3403-E3412. DOI 10.1073/pnas.1603269113 · PubMed

Other PDB entries of the same protein (UniProt Q86WV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MX3 1.36 Å, Crystal structure of human STING (G230A, H232R, R293Q) in complex with Compound 1
4EMT 1.5 Å, Crystal Structure of human STING bound to c-di-GMP
6UKZ 1.52 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 6
9CUD 1.53 Å, Human STING G230A/R293Q variant bound to diABZI-i
6UKU 1.68 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 3
7ZKU 1.7 Å, Crystal structure of human STING in complex with 3',3'-c-(2'F,2'dAMP-2'd<carba>GMP)
8STI 1.72 Å, human STING with agonist XMT-1616
6MX0 1.73 Å, Crystal structure of human STING apoprotein (G230A, H232R, R293Q)
6UKM 1.74 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound MSA-2
9VZG 1.74 Å, Harnessing Noncovalent Dimerization Enables an Orally Active STING Agonist for…
6UL0 1.76 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 4
6XNP 1.77 Å, Crystal Structure of Human STING CTD complex with SR-717

Browse structure collections

About this viewer

MolViewer shows 5JEJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.