Crystal structure of the central domain of human AKAP18 gamma/delta in complex with malonate. Determined by X-ray diffraction at 1.25 Å resolution. Released 3 Aug 2016.
Explore 5JJ2 in 3D Show helices and sheets RCSB PDB PDBe
5JJ2 contains 14 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 78-82 | 5 | |
| β-strand | 87-92 | 6 | 1 |
| α-helix | 96-112 | 17 | |
| α-helix | 114-119 | 6 | |
| β-strand | 120 | 1 | 2 |
| α-helix | 121-122 | 2 | |
| α-helix | 123-125 | 3 | |
| β-strand | 127-134 | 8 | 1 |
| α-helix | 138-159 | 22 | |
| β-strand | 165-174 | 10 | 2 |
| β-strand | 178-183 | 6 | 2 |
| α-helix | 184 | 1 | |
| α-helix | 187-205 | 19 | |
| β-strand | 209-210 | 2 | 1 |
| α-helix | 215-216 | 2 | |
| β-strand | 219-224 | 6 | 2 |
| α-helix | 225-227 | 3 | |
| α-helix | 229-232 | 4 | |
| α-helix | 241-247 | 7 | |
| β-strand | 251-256 | 6 | 2 |
| β-strand | 259-264 | 6 | 1 |
| α-helix | 268-270 | 3 | |
| α-helix | 274-276 | 3 | |
| β-strand | 277-282 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| A-kinase anchor protein 7 isoform gamma | A | protein | 211 | Homo sapiens | Q9P0M2 (AlphaFold model) |
>5JJ2_1 A-kinase anchor protein 7 isoform gamma (chains A) RKKKRKDYQPNYFLSIPITNKEIIKGIKILQNAIIQQDERLAKAMVSDGSFHITLLVMQL LNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEI AETANRTFQEKGILVGESRSFKPHLTFMKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEE ILYRIDLCSMLKKKQSNGYYHCESSIVIGEK
| ID | Name | Formula | Copies |
|---|---|---|---|
| MLI | Malonate ion | C3 H2 O4 | 6 |
Malonate in the nucleotide-binding site traps human AKAP18 gamma / delta in a novel conformational state. Bjerregaard-Andersen, K., stensen, E., Scott, J.D. et al. Acta Crystallogr F Struct Biol Commun (2016) 72:591-597. DOI 10.1107/S2053230X16010189 · PubMed
Other PDB entries of the same protein (UniProt Q9P0M2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5JJ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.