4ZP3: PDB entry 4ZP3
AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of regulatory subunits of PKA. Determined by X-ray diffraction at 2.63 Å resolution. Released 4 May 2016.
- Method
- X-ray diffraction
- Resolution
- 2.63 Å
- Organism
- Homo sapiens
- Chains
- 18
- Atoms
- 5,418
- Mol. weight
- 87.39 kDa
- Ligands
- CD
- Released
- 4 May 2016
Explore 4ZP3 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4ZP3 contains 32 α-helices and 0 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, B, D, F, J and L: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-23 | 15 | |
| α-helix | 28-41 | 14 | |
Chains C and E: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-8 | 3 | |
| α-helix | 9-23 | 15 | |
| α-helix | 28-41 | 14 | |
Chains G, H, I and K: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-23 | 15 | |
| α-helix | 28-42 | 15 | |
Chain M: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 50-75 | 26 | |
Chains N, Q and R: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 49-73 | 25 | |
Chain O: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 49-72 | 24 | |
Chain P: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 53-79 | 27 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| cAMP-dependent protein kinase type II-alpha regulatory subunit | A, B, C, D, E, F, G, H, I, J, K, L | protein | 43 | Homo sapiens | P13861 (AlphaFold model) |
| A-kinase anchor protein 7 isoforms alpha and beta | M, N, O, P, Q, R | protein | 40 | Homo sapiens | Q9P0M2 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L), FASTA
>4ZP3_1 cAMP-dependent protein kinase type II-alpha regulatory subunit (chains A, B, C, D, E, F, G, H, I, J, K, L)
SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREAR
Sequence of entity 2 (M, N, O, P, Q, R), FASTA
>4ZP3_2 A-kinase anchor protein 7 isoforms alpha and beta (chains M, N, O, P, Q, R)
NGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPG
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CD | Cadmium ion | Cd | 4 |
Primary citation
AKAP18:PKA-RII alpha structure reveals crucial anchor points for recognition of regulatory subunits of PKA. Gotz, F., Roske, Y., Schulz, M.S. et al. Biochem J (2016) 473:1881-1894. DOI 10.1042/BCJ20160242 · PubMed
Other PDB entries of the same protein (UniProt P13861 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2IZX 1.3 Å, Molecular Basis of AKAP Specificity for PKA Regulatory Subunits
- 5H78 2.0 Å, Crystal structure of the PKA-DHR14 fusion protein
- 9NXN 2.1 Å, Crystal structure of CN:RII alpha
- 5H77 3.2 Å, Crystal structure of the PKA-protein A fusion protein
- 5XBY 3.25 Å, Crystal structure of the PKA-Protein A fusion protein (end-to-end fusion)
- 2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to…
- 8S8O Solution Structure of cAMP-dependent Protein Kinase RII-alpha Subunit Dimerization and…
Browse structure collections
About this viewer
MolViewer shows 4ZP3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.