5JOG: CSN5(2-257)

Crystal structure of CSN5(2-257) in complex with CNS5i-3. Determined by X-ray diffraction at 2.46 Å resolution. Released 2 Nov 2016.

Method: X-ray diffraction
Resolution: 2.46 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,826
Mol. weight: 29.52 kDa
Ligands: ZN, 6LT
Released: 2 Nov 2016

Explore 5JOG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JOG contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	6-42	37
α-helix	44-46	3
β-strand	54-58	5	1
α-helix	59-71	13
β-strand	78-86	9	1
β-strand	89-97	9	1
α-helix	111-126	16
β-strand	132-139	8	1
α-helix	149-161	13
β-strand	166-170	5	1
β-strand	183-188	6	1
α-helix	189-190	2
α-helix	211-217	7
β-strand	221-223	3	1
β-strand	225-229	5	1
α-helix	233-235	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
COP9 signalosome complex subunit 5	A	protein	257	Homo sapiens	Q92905 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5JOG_1 COP9 signalosome complex subunit 5 (chains A)
GAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL
ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK
VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL
LWNKYWVNTLSSSSLLT

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
6LT	3-(difluoromethyl)-N-{6-[(5S,6S)-6-hydroxy-6,7,8,9-tetrahydro-5H-imidazo[1,5-a]…	C28 H29 F2 N5 O2	1

Primary citation

Targeted inhibition of the COP9 signalosome for treatment of cancer. Schlierf, A., Altmann, E., Quancard, J. et al. Nat Commun (2016) 7:13166-13166. DOI 10.1038/ncomms13166 · PubMed

Other PDB entries of the same protein (UniProt Q92905 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JOH 1.99 Å, Crystal structure of CSN5(2-257) in complex with CNS5i-1b
5M5Q 2.2 Å, COPS5(2-257) in complex with a azaindole (compound 4)
4F7O 2.6 Å, Crystal structure of CSN5
9QO4 2.95 Å, Dissociation-state-3 of 9-subunit CSN and SCF (SKP1-SKP2-CKS1) complex
9EFQ 2.96 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-2
9PH4 3.0 Å, Cryo-EM structure of COP9 signalosome in complex with CSN5i-1a
9QO6 3.0 Å, 9-subunit COP9 signalosome complex
9EFV 3.03 Å, Cryo-EM structure of CSN-N8CUL1 in complex with CSN5i-3
9EFM 3.16 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-1
9QO1 3.23 Å, Activated 9-subunit COP9 signalosome and neddylated SCF (SKP1-SKP2-CKS1) complex structure
9QO0 3.26 Å, Pre-activated 9-subunit COP9 signalosome and neddylated SCF (Skp1-Skp2-Cks1) complex…
9E77 3.3 Å, Cryo-EM structure of CSN-N8 in complex with CSN5i-3

Browse structure collections

About this viewer

MolViewer shows 5JOG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.