5JVU: PDB entry 5JVU

The neck-linker and alpha 7 helix of Drosophila melanogaster kinesin-1 fused to EB1. Determined by X-ray diffraction at 1.95 Å resolution. Released 3 Aug 2016.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Drosophila melanogaster, Homo sapiens
Chains: 2
Atoms: 1,403
Mol. weight: 20.21 kDa
Released: 3 Aug 2016

Explore 5JVU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JVU contains 8 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
α-helix	15-59	45
α-helix	61-63	3
α-helix	66-76	11
β-strand	77	1	1
β-strand	83	1	1

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	13-14	2
α-helix	15-59	45
α-helix	61-63	3
α-helix	66-76	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimera protein of Kinesin heavy chain and Microtubule-associated protein RP/EB family member 1	A, B	protein	85	Drosophila melanogaster, Homo sapiens	P17210 (AlphaFold model), Q15691 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5JVU_1 Chimera protein of Kinesin heavy chain and Microtubule-associated protein RP/EB family member 1 (chains A, B)
LSKNVVAVNEELTAEEWKRRYEKEKEKNARLKGKVEDLEKERDFYFGKLRNIELICQENE
GENDPVLQRIVDILYATDEGFVIPD

Primary citation

Family-specific Kinesin Structures Reveal Neck-linker Length Based on Initiation of the Coiled-coil. Phillips, R.K., Peter, L.G., Gilbert, S.P. et al. J Biol Chem (2016) 291:20372-20386. DOI 10.1074/jbc.M116.737577 · PubMed

Other PDB entries of the same protein (UniProt P17210 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JVR 2.1 Å, The neck-linker of Mus musculus KIF3A fused to the alpha 7 helix of Drosophila…
2Y65 2.2 Å, Crystal structure of Drosophila melanogaster kinesin-1 motor domain dimer-tail complex
5JVS 2.25 Å, The neck-linker + DAL and alpha 7 helix of Drosophila melanogaster Kinesin-1 fused to EB1
7BJS 2.28 Å, Crystal structure of Khc/atypical Tm1 complex
2Y5W 2.7 Å, Crystal structure of Drosophila melanogaster kinesin-1 motor domain dimer

Browse structure collections

About this viewer

MolViewer shows 5JVU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.