5JW7: SopA-Trim56 complex

Crystal structure of SopA-Trim56 complex. Determined by X-ray diffraction at 2.85 Å resolution. Released 15 Feb 2017.

Method: X-ray diffraction
Resolution: 2.85 Å
Organisms: Salmonella enterica subsp. enterica serovar Typhimurium, Homo sapiens
Chains: 2
Atoms: 2,395
Mol. weight: 41.37 kDa
Ligands: ZN
Released: 15 Feb 2017

Explore 5JW7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JW7 contains 17 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	170-183	14
α-helix	192-195	4
β-strand	196	1	1
β-strand	206	1	2
α-helix	207-210	4
β-strand	223-224	2	3
β-strand	227	1	1
β-strand	232	1	4
β-strand	237	1	2
β-strand	242-244	3	3
β-strand	247	1	1
β-strand	252	1	4
β-strand	257	1	2
β-strand	262-264	3	3
β-strand	267	1	1
β-strand	272-273	2	4
α-helix	282-283	2
β-strand	284-286	3	3
β-strand	289	1	1
β-strand	294-295	2	4
β-strand	300	1	3
β-strand	305	1	1
α-helix	308-310	3
β-strand	323-326	4	4
β-strand	329-332	4	4
α-helix	333-334	2
α-helix	339-346	8
α-helix	356-361	6
α-helix	365-367	3
α-helix	368-384	17
α-helix	389-392	4
α-helix	393-395	3
α-helix	396-403	8
α-helix	412-426	15

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	32-33	2	5
β-strand	39-40	2	5
α-helix	42-48	7
β-strand	54-55	2	6
β-strand	61-62	2	6
α-helix	63-65	3
α-helix	74-76	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase SopA	A	protein	282	Salmonella enterica subsp. enterica serovar Typhimurium	Q8ZNR3 (AlphaFold model)
E3 ubiquitin-protein ligase TRIM56	B	protein	93	Homo sapiens	Q9BRZ2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5JW7_1 E3 ubiquitin-protein ligase SopA (chains A)
GSGSENLYFQGGSGSATSSPSSPADWAKKLTDAVLRQKAGETLTAADRDFSNADFRNITF
SKILPPSFMERDGDIIKGFNFSNSKFTYSDISHLHFDECRFTYSTLSDVVCSNTKFSNSD
MNEVFLQYSITTQQQPSFIDTTLKNTLIRHKANLSGVILNEPDNSSPPSVSGGGNFIRLG
DIWLQMPLLWTENAVDGFLNHEHNNGKSILMTIDSLPDKYSQEKVQAMEDLVKSLRGGRL
TEACIRPVESSLVSVLAHPPYTQSALISEWLGPVQERFLEAL

Sequence of entity 2 (B), FASTA

>5JW7_2 E3 ubiquitin-protein ligase TRIM56 (chains B)
MVSHGSSPSLLEALSSDFLACKICLEQLRAPKTLPCLHTYCQDCLAQLADGGRVRCPECR
ETVPVPPEGVASFKTNFFVNGLLDLVKARACGD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural basis for the recognition and degradation of host TRIM proteins by Salmonella effector SopA. Fiskin, E., Bhogaraju, S., Herhaus, L. et al. Nat Commun (2017) 8:14004-14004. DOI 10.1038/ncomms14004 · PubMed

Other PDB entries of the same protein (UniProt Q8ZNR3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ST8 1.75 Å, Structure of E3 ligase SopA bound to ubiquitin
2QYU 2.1 Å, Crystal structure of Salmonella effector protein SopA
2QZA 2.8 Å, Crystal structure of Salmonella effector protein SopA
3SY2 3.27 Å, Crystal structure of the Salmonella E3 ubiquitin ligase SopA in complex with the human…

Browse structure collections

About this viewer

MolViewer shows 5JW7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.