6R80: AFF4 C-terminal homology domain

Structure of AFF4 C-terminal homology domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 12 Jun 2019.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,853
Mol. weight: 32.3 kDa
Released: 12 Jun 2019

Explore 6R80 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6R80 contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	915-931	17
α-helix	935-959	25
α-helix	967-981	15
α-helix	993-1016	24
α-helix	1018-1039	22
α-helix	1041-1042	2
α-helix	1087-1117	31
α-helix	1118-1120	3
α-helix	1121-1131	11
α-helix	1141-1159	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AF4/FMR2 family member 4	A	protein	284	Homo sapiens	Q9UHB7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6R80_1 AF4/FMR2 family member 4 (chains A)
MGSSHHHHHHENLYFQSNASKPRRTKLVFDDRNYSADHYLQEAKKLKHNADALSDRFEKA
VYYLDAVVSFIECGNALEKNAQESKSPFPMYSETVDLIKYTMKLKNYLAPDATAADKRLT
VLCLRCESLLYLRLFKLKKENALKYSKTLTEHLKNSYNNSQAPSPGLGSKAVGMPSPVSP
KLSPGNSGNYSSGASSASASGSSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKE
QKEFFAELDKVMGPLIFNASIMTDLVRYTRQGLHWLRQDAKLIS

Primary citation

Structure of the super-elongation complex subunit AFF4 C-terminal homology domain reveals requirements for AFF homo- and heterodimerization. Chen, Y., Cramer, P. J Biol Chem (2019) 294:10663-10673. DOI 10.1074/jbc.RA119.008577 · PubMed

Other PDB entries of the same protein (UniProt Q9UHB7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JW9 2.0 Å, The Crystal Structure of ELL2 Oclludin Domain and AFF4 peptide
6KN5 2.2 Å, Crystal structure of AFF4 C-terminal domain
6K7P 2.4 Å, Crystal structure of human AFF4-THD domain
4OR5 2.9 Å, Crystal structure of HIV-1 Tat complexed with human P-TEFb and AFF4
4IMY 2.94 Å, The AFF4 scaffold binds human P-TEFb adjacent to HIV Tat
4OGR 3.0 Å, crystal structure of P-TEFb complex with AFF4 and Tat
6CYT 3.5 Å, HIV-1 TAR loop in complex with Tat:AFF4:P-TEFb
5L1Z 5.9 Å, TAR complex with HIV-1 Tat-AFF4-P-TEFb

Browse structure collections

About this viewer

MolViewer shows 6R80 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.