5K5H: Transcriptional repressor CTCF

Homo sapiens CCCTC-binding factor (CTCF) ZnF4-7 and DNA complex structure. Determined by X-ray diffraction at 3.11 Å resolution. Released 24 May 2017.

Method: X-ray diffraction
Resolution: 3.11 Å
Organisms: Homo sapiens, synthetic construct
Chains: 3
Atoms: 1,443
Mol. weight: 22.41 kDa
Ligands: ZN
Released: 24 May 2017

Explore 5K5H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5K5H contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	351	1	1
β-strand	360	1	1
α-helix	364-374	11
α-helix	391-398	8
β-strand	407-408	2	2
β-strand	415-416	2	2
α-helix	419-429	11
β-strand	437-438	2	3
β-strand	445-446	2	3
α-helix	449-459	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcriptional repressor CTCF	A	protein	122	Homo sapiens	P49711 (AlphaFold model)
DNA (5'-d(cpapgpcpapgpgpgpgpgpcpgp*c)-3')	B	DNA	13	synthetic construct
DNA (5'-d(cpgpcpcpcpcpcptpgpcptpgp*g)-3')	C	DNA	13	synthetic construct

Sequence of entity 1 (A), FASTA

>5K5H_1 Transcriptional repressor CTCF (chains A)
GPLGSEKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHS
GEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSY
IE

Sequence of entity 2 (B), FASTA

>5K5H_2 DNA (5'-D(*CP*AP*GP*CP*AP*GP*GP*GP*GP*GP*CP*GP*C)-3') (chains B)
CAGCAGGGGGCGC

Sequence of entity 3 (C), FASTA

>5K5H_3 DNA (5'-D(*CP*GP*CP*CP*CP*CP*CP*TP*GP*CP*TP*GP*G)-3') (chains C)
CGCCCCCTGCTGG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA. Hashimoto, H., Wang, D., Horton, J.R. et al. Mol Cell (2017) 66:711-720.e3. DOI 10.1016/j.molcel.2017.05.004 · PubMed

Other PDB entries of the same protein (UniProt P49711 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5KKQ 1.74 Å, Homo sapiens CCCTC-binding factor (CTCF) ZnF3-7 and DNA complex structure
5YEG 2.0 Å, Crystal structure of CTCF ZFs4-8-Hs5-1a complex
5K5I 2.19 Å, Homo sapiens CCCTC-binding factor (CTCF) ZnF5-8 and DNA complex structure in space group…
5T00 2.19 Å, Human CTCF ZnF3-7 and methylated DNA complex
8SST 2.19 Å, ZnFs 1-7 of CCCTC-binding factor (CTCF) K365T Mutant Complexed with 23mer
5K5J 2.29 Å, Homo sapiens CCCTC-binding factor (CTCF) ZnF5-8 and DNA complex structure in space group…
8SSS 2.3 Å, ZnFs 1-7 of CCCTC-binding factor (CTCF) Complexed with 23mer
5YEH 2.33 Å, Crystal structure of CTCF ZFs4-8-eCBS
5UND 2.55 Å, Crystal Structure of CTCF(ZnF 4-10) With 28-mer DNA
6QNX 2.7 Å, Structure of the SA2/SCC1/CTCF complex
5YEF 2.81 Å, Crystal structure of CTCF ZFs2-8-Hs5-1aE
8SSU 2.89 Å, ZnFs 3-11 of CCCTC-binding factor (CTCF) Complexed with 19mer DNA

Browse structure collections

About this viewer

MolViewer shows 5K5H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.