Wilms Tumor Protein (WT1) ZnF2-4 Q369H in complex with formylated DNA. Determined by X-ray diffraction at 1.78 Å resolution. Released 14 Sept 2016.
Explore 5KL4 in 3D Show helices and sheets RCSB PDB PDBe
5KL4 contains 6 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 353-354 | 2 | 1 |
| β-strand | 363-364 | 2 | 1 |
| α-helix | 367-378 | 12 | |
| β-strand | 383-384 | 2 | 2 |
| β-strand | 391-392 | 2 | 2 |
| α-helix | 395-406 | 12 | |
| β-strand | 411-412 | 2 | 3 |
| β-strand | 421-422 | 2 | 3 |
| α-helix | 425-436 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 353-354 | 2 | 4 |
| β-strand | 363-364 | 2 | 4 |
| α-helix | 367-378 | 12 | |
| β-strand | 383-384 | 2 | 5 |
| β-strand | 391-392 | 2 | 5 |
| α-helix | 395-406 | 12 | |
| β-strand | 411-412 | 2 | 6 |
| β-strand | 421-422 | 2 | 6 |
| α-helix | 425-435 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Wilms tumor protein | A, D | protein | 93 | Homo sapiens | P19544 (AlphaFold model) |
| DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*(5FC)P*GP*T)-3') | B, E | DNA | 11 | synthetic construct | |
| DNA (5'-D(*TP*AP*(5CM)P*GP*CP*CP*CP*AP*CP*GP*C)-3') | C, F | DNA | 11 | synthetic construct |
>5KL4_1 Wilms tumor protein (chains A, D) GPLGSEKPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRT HTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
>5KL4_2 DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*(5FC)P*GP*T)-3') (chains B, E) AGCGTGGGCGT
>5KL4_3 DNA (5'-D(*TP*AP*(5CM)P*GP*CP*CP*CP*AP*CP*GP*C)-3') (chains C, F) TACGCCCACGC
Water and common crystallization additives (NA, EDO) are not listed.
Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications. Hashimoto, H., Zhang, X., Zheng, Y. et al. Nucleic Acids Res (2016) 44:10165-10176. DOI 10.1093/nar/gkw766 · PubMed
Other PDB entries of the same protein (UniProt P19544 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5KL4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.