Crystal structure of mouse Bak BH3-in-groove homodimer (GFP). Determined by X-ray diffraction at 2.8 Å resolution. Released 17 Aug 2016.
Explore 5KTG in 3D Show helices and sheets RCSB PDB PDBe
5KTG contains 21 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-9 | 6 | |
| β-strand | 12-22 | 11 | 1 |
| β-strand | 25-36 | 12 | 1 |
| β-strand | 41-48 | 8 | 1 |
| α-helix | 57-60 | 4 | |
| α-helix | 69-71 | 3 | |
| β-strand | 73 | 1 | 1 |
| α-helix | 74 | 1 | |
| α-helix | 76-81 | 6 | |
| α-helix | 83-87 | 5 | |
| β-strand | 92-100 | 9 | 1 |
| β-strand | 105-115 | 11 | 1 |
| β-strand | 118-128 | 11 | 1 |
| β-strand | 141 | 1 | 2 |
| β-strand | 148-155 | 8 | 1 |
| α-helix | 156-158 | 3 | |
| β-strand | 160-170 | 11 | 1 |
| β-strand | 171 | 1 | 2 |
| β-strand | 176-187 | 12 | 1 |
| α-helix | 194-197 | 4 | |
| β-strand | 199-208 | 10 | 1 |
| β-strand | 217-227 | 11 | 1 |
| α-helix | 1067-1070 | 4 | |
| α-helix | 1072-1098 | 27 | |
| α-helix | 1105-1117 | 13 | |
| α-helix | 1123-1142 | 20 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-22 | 11 | 3 |
| β-strand | 25-36 | 12 | 3 |
| β-strand | 41-47 | 7 | 3 |
| α-helix | 57-60 | 4 | |
| α-helix | 69-71 | 3 | |
| β-strand | 73 | 1 | 3 |
| α-helix | 74 | 1 | |
| α-helix | 79-81 | 3 | |
| α-helix | 84-87 | 4 | |
| β-strand | 92-100 | 9 | 3 |
| β-strand | 105-115 | 11 | 3 |
| β-strand | 118-128 | 11 | 3 |
| β-strand | 141 | 1 | 4 |
| β-strand | 148-155 | 8 | 3 |
| β-strand | 160-170 | 11 | 3 |
| β-strand | 171 | 1 | 4 |
| β-strand | 176-187 | 12 | 3 |
| α-helix | 196-197 | 2 | |
| β-strand | 199-208 | 10 | 3 |
| β-strand | 217-227 | 11 | 3 |
| α-helix | 231-1095 | 32 | |
| α-helix | 1102-1117 | 16 | |
| α-helix | 1123-1142 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Green fluorescent protein, Bcl-2 homologous antagonist/killer | A, B | protein | 309 | Aequorea victoria, Mus musculus | O08734 (AlphaFold model), P42212 (AlphaFold model) |
>5KTG_1 Green fluorescent protein, Bcl-2 homologous antagonist/killer (chains A, B) MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL VTTFXVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNR IELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHY QQNTPIGDGPVLLPDNHYLSTQSNLSKDPNEKRDHMVLLEFVTAAGITGSNSILGQVGRQ LALIGDDICRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYR LALYVYQRG
Assembly of Bak homodimers into higher order homooligomers in the mitochondrial apoptotic pore. Mandal, T., Shin, S., Aluvila, S. et al. Sci Rep (2016) 6:30763-30763. DOI 10.1038/srep30763 · PubMed
Other PDB entries of the same protein (UniProt O08734 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5KTG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.